The 10 Best Web Design Agencies in Florida (2024)

Best Web Design Agencies in Florida

Featured providers

  • Dot Com Development

    Dot Com Developmentcertified-flagverified-flagfeatured-flag

    5
    (8 reviews)

    On Time ... On Budget ... Solutions Exceeding Expectation

    Recommended
    Award-winner
    Dot Com Development is a and awarded and top software development & IT consulting company offering innovative solutions for diverse industry verticals. We strive to be an invaluable catalyst for building a culture of innovation. Our breakthrough web and mobile solutions have the capability to challenge the limits and give business a competitive edge. Our services include Strategic Planning and Consulting UX/UI Design Prototyping and POC's Web Application Development Mobile Application Development eCommerce / mCommerce Development Cloud Development CRM / ERP Development AI/ML Development DevOps Services
    6 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • ABC DIGITAL (by ABCW)

    ABC DIGITAL (by ABCW)certified-flagverified-flagfeatured-flag

    4.6
    (11 reviews)

    Se parte de la Revolución Digital Global

    Recommended
    Award-winner
    ABC Digital es una de las agencias holding de ABCW, contamos con más de 12 años de experiencia en el mercado y contamos con el mejor talento internacional. Hemos sido reconocidos como "la mejor agencia de publicidad internacional" por Merca 2.0. Contamos con más de 200 colaboradores que se encargan de crear estrategias digitales integrales, innovadoras y a la vanguardia de las tendencias globales de marketing digital. Algunos de nuestros servicios son: SEO, gestión y manejo de redes sociales, campañas publicitarias en medios digitales, estrategias de inbound marketing y desarrollo de sitios web, e-commerce, aplicaciones móviles y landing pages con alta experiencia de usuario e interactividad. Algunos de nuestros clientes son: Playa Resorts, EY, Energizer, Maple Bear, Panasonic, entre otros, con los cuales hemos logrado llevar sus resultados a otro nivel. Actualmente somos Google Premier Partners, Meta Business Partners, Hubspot Partners y contamos con acceso a Amazon Web Services, aportando alto valor en las estrategias de cada uno de sus clientes. 🇺🇸 https://abcdigitalagency.us/ 🇲🇽 https://www.abcdigital.mx/ 🇨🇴 https://abcdigital.com.co/
    1 work in Website Creation
    Active in Florida, United States
    From €800 for Website Creation
  • Brightscout

    Brightscoutcertified-flagverified-flagfeatured-flag

    5
    (1 review)

    Transforming the World's Most Innovative Businesses with Uniquely Crafted Brands and Standout Apps.

    Award-winner
    Brightscout is a global branding and app development studio built from the best talent in the world. We strive to transform the world’s most innovative businesses through a powerful mix of exquisite design, development, and strategy solutions. We partner with leaders and entrepreneurs at critical inflection points to help them better connect and engage with their customers. Together we build brands, products, and all the digital experiences in between to support growth in competitive markets.
    1 work in Website Creation
    Active in Florida, United States
    From €25000 for Website Creation
  • Strawberry Brand Studio

    Strawberry Brand Studiocertified-flagverified-flagfeatured-flag

    5
    (5 reviews)

    We craft world-class brands

    Recommended
    We’re Strawberry Brand Studio, a full-service branding agency obsessed in transforming ideas into powerful brand identities. Our clients are ambitious, passionate business owners and division heads who value our inquisitive, international mindset. With a focus in building brands from concept to execution, our multi-cultural team of brand strategists, designers, creatives, problem solvers and idea generators elevate brands to the next level. Our promise is sweet & simple: create brands anchored on purpose, brought to life in a cohesive and compelling way. We begin always with the "why?", digging deep to find a brand's true essence. From that point on, creativity takes the lead and the result of our work is the crafting of a compelling brand for its desired audience. We are based in Lisbon, Portugal with offices in Miami and Singapore, but like our team, our clients hail from all corners of the world.
    23 works in Website Creation
    Active in Florida, United States
    From €5000 for Website Creation
  • Minsite

    Minsitecertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    Designing Web Experiences That Wow

    Recommended
    Award-winner
    We are Minsite, a web design agency from New York. We create amazing websites that captivate and convert visitors into customers and sales. Whether you need a website for your business, a blog, or an online store, we are here to make it possible. At Minsite, simplicity is the key to a memorable web experience. Simplicity is a philosophy that permeates everything we do. We believe in clarity, transparency, and honesty in communication with all our clients and project management. The name Minsite is a combination of minimalism and ‘website.’ We draw inspiration from minimalism as a philosophy of life that we deeply value. We are committed to bringing this philosophy to every project we undertake, making the process of working with us easier and more enjoyable.
    5 works in Website Creation
    Active in Florida, United States
    From €10000 for Website Creation
  • Darkside by Ben Walsh

    Darkside by Ben Walshcertified-flagverified-flagfeatured-flag

    4.6
    (4 reviews)

    Fixing F🤬cked Up Brands and Websites Fast

    Recommended
    Award-winner
    Armed with our zero-bullsh*t framework, clear communication and lean design approach, we transform your business in weeks. Branding: Develop a brand strategy and create an identity that resonates with your audience. Websites: Design and build your website using Webflow. We also use our 20 years in tech to help your software look its best and deliver a solid experience to your users. UX Roadmap Audit: Evaluate the state of your Product's UX and UI. UX Design Sprint: 30 days of Unlimited UX and UI design support from a team of experts.
    3 works in Website Creation
    Active in Florida, United States
    From €1200 for Website Creation

Best Web Design Agencies in Florida

Sort by
  • Tech4States

    Tech4Statescertified-flagverified-flagfeatured-flag

    5
    (10 reviews)

    Top full-stack Web Development & Marketing Agency.

    Recommended
    Tech4States is a full-stack creative agency offering a wide array of services in digital marketing, web design and development, ecommerce development, app design, and creative writing.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Luby

    Lubyverified-flagfeatured-flag

    5
    (4 reviews)

    Welcome to Technology Applied right

    Recommended
    For 20 years, Luby has been digitally transforming companies in Brazil, the U.S., and Europe, scaling the ability to design and launch high-impact digital products through exceptional teams. International Presence +300 Talented Lubers +40 Mastered Technologies +500 Attended Customers +1000 Projects Delivered +20 Years in the Market We are a strategic partner to co-create successful digital products that solve real-world problems with high performance and agility. We serve from startups to medium and large companies in the digital transformation phase, with software solutions focused on business vision and execution capacity.
    5 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Alfatek Digital

    Alfatek Digitalverified-flagfeatured-flag

    4.8
    (2 reviews)

    ATD is an agency committed to bringing brands to life

    Recommended
    A Data-Driven Creative Digital Marketing Agency Focused on Delivering Real Results, Alfatek Digital (ATD) is a premium digital marketing company comprised of a team of creative designers, skillful developers, and top-notch digital marketing specialists. We offer tailor-made websites and digital marketing solutions that help you identify, reach out and engage with your target audience in unique ways. Leveraging the knowledge and experience of our team, we strategically build and share the brand story that is a true reflection of your values and business. Moreover, we increase your brand visibility, boost traffic, generate leads and sales while building loyalty through our cutting-edge digital marketing strategy. Through our innovative digital results, we put your brand on the top of your game.
    3 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Octal IT Solution

    Octal IT Solutioncertified-flagverified-flagfeatured-flag

    (0 review)

    Offshore IT Solutions

    Octal IT Solution is an ISO 9001:2015 Certified Company with its physical presence in the USA, UK, India, Singapore & Dubai, and serving its clients across the globe. Established in the year 2004, Octal IT Solution has developed more than 1,100 Mobile and Web Apps for over 700 clients from all parts of the world. With a team of 150+ seasoned professionals, we offer innovative solutions from our well-established development centers as well as through onsite work environments. With top-notch & affordable solutions, Octal IT Solution has earned notable associations from technology leaders like Microsoft, NASSCOM, Amazon Web Services, Acquia, STPI, D&B and many more. We are appreciated by hundreds of clients on AppFutura, Clutch, GoodFirms, AppLancer, Appdexa, and Extract, consistently being among the Top-10 Mobile App Developers on these platforms. GoodFirms Listed Octal IT Solution as the best web design solutions, giving organizations in a survey of global web design companies, was conducted among 200+ web design agencies adjoining with freelance web designers. Octal IT Solutions specializes in fantasy Sports and E-Wallet App Development, delivering cutting-edge technology solutions for modern digital transactions and gaming experiences.  
    8 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Spectra Studio

    Spectra Studiocertified-flagverified-flagfeatured-flag

    (0 review)
    Website Design ☆ Logo Design ☆ Social Media Marketing > Logo Design and Branding Packages > Website Design Packages: Sample OnRouteTowing . ca or DezinerOptix . com > Website Video Spokesperson Packages > Search Engine Optimization Packages > Social Media Marketing Packages > Website and Email Hosting Packages Spectra Studio is a leading graphic design company rated highly in the design industry for creative web graphic design solutions , brand identity, web design, and website development. We are a world-renowned graphic design company bringing all design experts in the field to work and achieve excellent results for your design needs. Our graphic design team specializes in building brand recognition to ensure that your company or product stands apart from your competition. From small start-up companies in need of logo design and branding collaterals such as brochures and business cards to Medium and Large Companies searching for the right web design and development agency to handle their complete web design solution and marketing campaign -- Spectra Studio will deliver!!
    7 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Lightspace

    Lightspaceverified-flagfeatured-flag

    (0 review)

    We help brands launch and grow through technology and design.

    We are a US-based design and development agency working on projects around the world. We support businesses of all sizes throughout their journey from idea to launch, or by helping them elevate their business and scale. Our team is an international blend of creatives and tech experts, specializing in branding, design and development services.
    7 works in Website Creation
    Active in Florida, United States
    From €3000 for Website Creation
  • Absolute Web

    Absolute Webverified-flagfeatured-flag

    5
    (2 reviews)
    Award-winner
    Our name really tells you everything you need to know, Absolute Web is a Creative Digital Commerce Agency, established in 1999, providing your business with results in absolutely any aspect of marketing. A highly skilled team comprised of web designers and developers, e-commerce managers, content creators and marketing experts with years of experience in the industry, are ready to grow businesses across many platforms and industries. Led by an entrepreneurial spirit, we treat every client’s business as our own. Taking the time to fully immerse ourselves in their respective industry by identifying competition, trends, failures, and successes is key to working with our clients to developing tailor-made strategies that produce results. Absolute Web is a full-service agency with strong abilities in ecommerce development and management as well as marketing, photography, video and content creation. Based in Miami, we specialize in custom development of Ecommerce Solutions on Magento, Shopify & BigCommerce platforms, informed by strategy and guided by our client’s goals we utilize all of our assets and expertise to ensure results.
    3 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Ideafoster

    Ideafostercertified-flagverified-flagfeatured-flag

    4.7
    (15 reviews)

    We help our client from discovering opportunities to profitable solutions and everything in between!

    Recommended
    Award-winner
    (EN) We are problem solvers who bring customer-centric solutions to the market at high speed and with lower risk. We’re unblocking innovation by combining top experts in their fields with our proven methodologies and unique services. We empower teams to innovate. We help them develop in-house employee-driven innovation programs, in order to generate, prototype, and test ideas that accelerate growth. The Innoverse deploys a fully functioning innovation program aimed to empower employees within your organization, in order for them to identify new business opportunities and launch ideas that accelerate growth. What makes us stand out, apart from our experience and capabilities, is the experienced ecosystem of +40 providers who work with Ideafoster team. We’ve built an ecosystem of state-of-the-art partners that work together with us to deliver innovation in a more agile and effective approach. Thanks to our network and customized technological development, we help companies prototype and test ideas faster than their fastest competitors. We've proven excellence in the areas of UX/UI, AI, 3D Printing, Data, Blockchain, and Digital Product Development. (ES) Ideafoster es una empresa de consultora de Innovación Rápida. Somos un equipo resolutivo que ofrece soluciones centradas en el cliente, a una alta velocidad y con el menor riesgo. Desbloqueamos la innovación al combinar los mejores expertos en sus campos, junto con nuestras metodologías comprobadas y servicios únicos. Nosotros empoderamos a equipos a innovar. Les ayudamos a desarrollar programas de innovación internos por y para empleados, a fin de generar, prototipar y testear ideas que aceleran el crecimiento. El proyecto Innoverse utiliza un programa de innovación totalmente funcional hecho para empoderar a los empleados de la organización a encontrar nuevas oportunidades de negocio y lanzar nuevas ideas. Lo que nos hace destacar, aparte de nuestra experiencia y capacidades, es nuestro ecosistema de más de 40 profesionales que trabajan con el equipo de Ideafoster. Hemos creado un ecosistema de partners de vanguardia que trabajan junto con nosotros para entregar innovación de forma más ágil y eficiente. Gracias a nuestro network y nuestro equipo personalizado de desarrollo tecnológico, ayudamos a las empresas a prototipar y testear ideas mucho más rápidas que sus competidores . Hemos demostrado nuestra excelencia en áreas como UX/UI, Impresión 3D, Data, IA, Blockchain y Desarrollo de Producto Digital.
    15 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Hoopla digital agency

    Hoopla digital agencyverified-flag

    4.8
    (3 reviews)

    A KICK ASS DIGITAL ADVERTISING AGENCY

    Recommended
    Award-winner
    Hoopla is an interactive and digital advertising agency, whose existence is aimed to develop exceptional communication pieces. No one gets in trouble for always being the same. Nobody remembers what is already done. Our job is to push the limits. Improve your communication. We are a creative agency. We create strategies, designs and productions on every social media platform. We are always looking for the latest trends to constantly innovate. At the end of the day, we are a strategic partner for the communication of modern brands
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Ciphers Lab LLC

    Ciphers Lab LLCcertified-flagverified-flag

    (0 review)

    Product UI/UX Designing, Frontend & Backend Engineering as a Service.

    With us, Product & Service companies get their Favourite Product Designers, Frontend & Backend Engineers whenever they need them at half the cost they would pay in-house.
    4 works in Website Creation
    Active in Florida, United States
    From €750 for Website Creation
  • PUSH MEDIA

    PUSH MEDIAverified-flag

    (0 review)
    Award-winner
    What we do   We have a wide range of experience, expertise and tools to create and implement your campaigns, from web development, ecommerce, social media, to carefully curating awesome content to optimising it online with our great SEO and PPC powers, not to mention exceptional social media. The backbone to our strategic process is the data-backed content we create, which has been endlessly researched so it’s the best and most relevant it can be. Our team works hard to ensure that your content is served up like a big juicy steak (vegetarians also welcome), and we aren’t finished until we’ve served a delicious three-course meal that leaves you satisfied.   How We Do It   To get under the skin of your content, we match your project with the team members best-suited to it. We may be in digital marketing but we work human to human, so we’ll work closely with you to really get under the skin of your goals. You’ll notice that we don’t like to overcomplicate things – so we only use technical jargon if we’re going for a triple-word score in Scrabble.   Help Us Help You   Here at PUSH MEDIA we appreciate your goals and understand the confusing and crazy world of digital marketing, meaning we can guide you through the best avenue for your online objectives. If you want to succeed online and you’re ready to explore the options available to you, get in touch! We’d love to hear from you!
    3 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Award-winner
    DigitlHaus is an award winning, full-service, BigCommerce, Shopify Plus and Magento Commerce agency. From concept to conversion, we create B2B and DTC brand experiences that connect with the consumer and convert.
    3 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Unfold

    Unfoldcertified-flagverified-flag

    5
    (3 reviews)
    Creative Digital Design Agency - Clients include: Facebook, Samsung, Berkshire Hathaway, Ripple, PayPal, Adobe & More.   Services we focus on: BRAND IDENTITY: From ideation to execution - Unfold will discover the brand that simply fits and leaves an impression in the minds of your audience. WEB DESIGN: User experience (UX) is key for an effective website strategy. Unfold follows the latest design standards to deliver a beautiful and functional digital product. APP UI + UX DESIGN: Standing out from your competition is vital in the vast amount of existing apps in the market. Unfold creates an experience and design like no other. ILLUSTRATIONS: Let's get artsy! Unfold does a wide range of illustrative work to keep you looking fresh and active, from a wide variety of artistic styles.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Award-winner
    SpryBit is an IT consultation and solution provider which is home to some of the best skilled technical professionals in the industry. We offer services like Custom Website Design & Development, UI UX Design, Mobile Application Development (Android, iOS, Hybrid), E-commerce Development, CMS-based website Development, IoT, Frontend Technology, Microsoft Technology Development Services, MYOB Integration, Automation Testing Services, Hire dedicated developers Services and more. At SpryBit, our team of professionals put their hardships to develop a unique eye-catchy web design, we introduce mobile applications suitably customized as per client’s requirements as well as we pinch out eminent e-commerce tools for client’s business dealing transactions, totally risk-free.
    3 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Simform

    Simformverified-flag

    (0 review)

    Digital Product Engineering and Talent Solutions

    Award-winner
    Simform is a digital product engineering and IT talent solutions company with a mission to solve complex software engineering problems. Since 2010, our team of 1000+ experts has helped businesses elevate their value through our development services. Our flexible global delivery center transforms your engineering from being bottlenecks to growth drivers. We help you to identify and solve critical business challenges with proven technology practices such as DevOps, cloud-native development, and testing services. Our remote agile teams of engineers immerse themselves in your project, maintaining your company culture and working in line with your strategic goals. SERVICES: 1. Digital Product Engineering: Product engineering Performance engineering and testing Application modernization Digital experience design Software development services Blockchain engineering 2. Cloud Native Engineering Cloud native development DevOps Engineering Data Engineering 3. Technology Practices Project strategy Process management Technology partnerships Software testing AWARDS AND CERTIFICATION: AWS Advanced Consulting Partner | Microsoft Partner OUR PROCESS: Share your requirements and get a free consultation Wireframing Agile Development Testing Delivery Support & Maintenance WHY SHOULD YOU WORK WITH US? -> We help you decide the right architecture and processes to follow and oversee the successful delivery of your software projects. -> Partners with best technology providers: As Advanced AWS consulting partner and Azure Gold partner. Simform brings you the superpower of cloud-native applications. -> We take security and IP protection very seriously. We follow enterprise-wide processes to build secure development, testing, and deployment environments. To get a free consultation, visit our website and fill up the contact form. You can also send a message from here.
    3 works in Website Creation
    Active in Florida, United States
    From €5000 for Website Creation
  • Doc Digital SEM

    Doc Digital SEMcertified-flagverified-flag

    5
    (3 reviews)

    Your Digital Marketing Doctor

    Recommended
    Doc Digital SEM is a full-suite digital marketing agency that specializes in Medical Marketing. Our medical marketing agency provides time-tested and proven marketing strategies that work well for new patient acquisition. Let us create a lead generation campaign through top-of-the-line digital marketing campaigns for you! You will love the results, and so will your new patients! Our Digital Marketing for Medical Clinic services are second to none!
    No work in Website Creation
    Active in Florida, United States
    From €250 for Website Creation
  • Third dimension studio

    Third dimension studiocertified-flagverified-flag

    (0 review)

    Elevate Your Online Presence With Award-Winning Web Design

    Award-winner
    We create memorable interactive websites that help companies build their brand
    3 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • wdmarketingdigital

    wdmarketingdigitalverified-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    1 work in Website Creation
    Active in Florida, United States
    From €400 for Website Creation
  • Fairhead Creative is a leading web design company based in Florida and serves web services like UX website design and development, SEO, graphic design, branding , etc at Tampa, Clearwater, St. Pete, Miami, Orlando and Florida . We have got many years of industry experience and passion for helping businesses better and serve their customers online. We love making great websites for our customers. Our developer has many years of experience in UX website development. Do you have any questions for our web services? Contact our phone support team @ 1-813-644-9944. 
    2 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • LibraFire

    LibraFirecertified-flagverified-flag

    (0 review)
    We are a team of development engineers and designers who firmly believe in the highest quality of work, no matter what the task and the conditions are, quality remains at the same level, we would say that the pursuit of quality is the fuel which drives us to achieving excellence of the end result. We are always on the lookout for the best and most efficient solutions. Dedication, pro-activeness and precision are qualities on which we are especially proud of. What we do? We design and develop customized, intuitive and advanced solutions with a dedication to provide services of the highest quality at the lowest possible cost so you’ll get the most bang for the buck. Why Us? The answer to this question is never an easy one, but we guarantee it is the one you need to hear. Because we believe in synergy that is based on win-win scenarios and mutual satisfaction, and because we always get the job done on time. If you highly value honesty, pro-activeness, high quality of work, dedication to the work look no further we are here to assist. Allow us to demonstrate the difference!
    2 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Gig Miami

    Gig Miamiverified-flag

    (0 review)
    Award-winner
      We are experts in the branding and e-commerce field, with a holistic focus on fashion, lifestyle, and wellness specialized brands. Our ambition is to cultivate a highly successful and integral brand experience to meet all of your business needs. At Gig Miami, we believe your business goals should be in alignment with well-crafted and effective digital communication. It is our promise to you that all of the services you require to promote your brand will be provided with expertise, love, and dedication that stands the test of time.   64% of consumers say that shared values are the main reason that they have a trusted relationship with a brand. Do you know if your website and marketing materials are truly aligned with your brand’s values? Running marketing campaigns or employing new strategies without getting your branding right first is like shouting at a brick wall. Why? Because your ideal customers aren’t going to listen if your brand doesn’t resonate with them. Branding is everything in business - especially in fashion. When done right, it allows you to connect with your ideal customers who identify with your brand values and aesthetic.   My expertise is to help brands create a beautiful visual identity with compelling messaging that communicates their brand’s values and connects them with their ideal customers, all without the big price tag that often comes along with it. If you’re open to learning more, let’s talk. Book a call with me and receive a free brand audit: https://calendly.com/gigmiami   Services,    Web design. Design and develop a website using Modern fonts. Up to 6 designed Squarespace pages Custom CSS added Responsive design Basic SEO added to website Graphics   Responsive E-commerce Design Design and develop a Flagship E-commerce Customized design for a unique brand experience Custom CSS Responsive design SEO added to website Curated Images & Graphics We have a strong experience with Shopify, Magento...   Full Branding Experience Brand Strategy Logo design Copywriting - Mission, Vision, Values Social media graphics, newsletter design, business cards Brand guideline PDF
    2 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Dean Infotech Pvt Ltd

    Dean Infotech Pvt Ltdverified-flag

    5
    (2 reviews)

    Salesforce, Hubspot, Web and Mobile App Development Services

    Recommended
    Award-winner
    Dean Infotech is a Certified Salesforce Partner Company . Offering Salesforce Consultation, Development and Implementation Services. With 12+ years of experience in the industry, we have worked on 200+ Projects along with some of the Foutune 500 companies around the globe inclding USA, UK , Australia and Europe with an experience in diverse industry. We provide end-to-end Salesforce and Hubsopt CRM Development, Software Development, Website Designing & Development, and Mobile Apps Development. Our team of 150+ experienced developers, designers, and consultants possesses a deep understanding of the latest technologies and industry best practices. Why Choose Us? - 300+ Clients Served Globally - 200+ Successful Projects - 100+ Technology Specialist - Flexible Hiring Plans - Boutique Quality - 99.99% Up time Guarantee Our Services: - Software Development Services - Salesforce Development Services - Hubspot Development Services - CRM Solutions - Advanced Web Design and Development Services - Custom Enterprise Software Development Services - Mobile App Development (Android and iOS) Services - Technical Staff Augmentation We're not just transforming businesses; we're shaping the future, one byte at a time!
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • oMesh Werbeagentur

    oMesh Werbeagenturcertified-flagverified-flag

    (0 review)

    Umsatzstarke Webpräsenz

    Willkommen bei unserer erfolgreichen Werbeagentur! Wir sind spezialisiert auf die Erstellung von maßgeschneiderten Websites und umsatzorientierten Onlineshops für Geschäftskunden. Unser Ziel ist es, Ihren Online-Auftritt zu optimieren und Ihnen dabei zu helfen, Ihre Zielgruppe effektiv zu erreichen. Wir wissen, dass eine gute Website oder ein Onlineshop heutzutage unerlässlich ist, um erfolgreich zu sein. Deshalb arbeiten wir eng mit Ihnen zusammen, um eine maßgeschneiderte Lösung zu finden, die Ihren Bedürfnissen und Ihrem Budget entspricht. Dabei legen wir Wert auf eine benutzerfreundliche Navigation, ein ansprechendes Design und eine hohe Funktionalität. Darüber hinaus bieten wir Ihnen auch professionelles Social-Media-Management an. Wir helfen Ihnen dabei, Ihre Social-Media-Kanäle effektiv zu managen und Ihre Reichweite zu maximieren. Dabei setzen wir auf eine individuelle Strategie, die genau auf Ihre Bedürfnisse und Ziele zugeschnitten ist. Vertrauen Sie auf unsere langjährige Erfahrung und unser Know-how, um Ihr Unternehmen erfolgreich online zu präsentieren. Kontaktieren Sie uns noch heute, um mehr darüber zu erfahren, wie wir Ihnen helfen können. https://youtu.be/PpgS8KYKbMU
    2 works in Website Creation
    Active in Florida, United States
    From €65 for Website Creation
  • Merton Way

    Merton Waycertified-flagverified-flag

    (0 review)

    Building B2B Brands to Outperform.

    Merton Way is a hybrid digital marketing agency and business consultancy. We serve early stage companies and divisions of large corporations to launch new brands, products, and services. Some come to us to help turn around a brand or business with P&L challenges. We are full service, providing branding and strategy, research, SEM, SEO, web and ecommerce development, and copywriting for complex or highly technical solutions. More than that, we are business people with management experience at companies like IBM, Apple, and Toyota. We get it.
    2 works in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Web Traffic Strategist Inc.

    Web Traffic Strategist Inc.certified-flagverified-flag

    (0 review)

    Web Traffic Strategist main focus is on leads, combining our SEM your (ROI) will grow every month!

    Award-winner
    Web Traffic Strategist's name was picked out for a reason. As we understand sales in the SEO services field we noticed the promises some agencies made when pitching to business owners. They offer rankings that did not bring the right users to take action that would lead to sales. Most agencies do not focus on what a small to medium business needs to stay afloat or grow, which is sales! Without a well online marketing strategy most business fail. We focus on (ROI) and are selective with companies we work with because good results such as leads depends on how visible you are, brand authority, and other factors your business has or lacks. T hat's why you need an online consultation explaining your strenghts and weakness in your industry, call us to understand where you stand among your competitors and what and how long is going to take to see $$$$$$$ your return on investment!
    2 works in Website Creation
    Active in Florida, United States
    From €3000 for Website Creation
  • LinkingAds

    LinkingAdsverified-flag

    4.6
    (1 review)
    Recommended
    Award-winner
    We’re focused on providing our clients with optimal digital marketing solutions that always result in new generated leads online. Our team is made of carefully picked go-getters who are ready to help you and your business rise above the competition in the search results. What makes us different from all the other agencies is that we are results driven, we are also perfectionists so what ever we do we will make sure it's perfect. Our real-time transparency reporting will always let you know what's going on. 
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Edbrig

    Edbrigcertified-flagverified-flag

    5
    (1 review)
    Recommended
    We are an independent branding and advertising agency , who helps brands to stand out with the help of our branding and advertising services. Edbrig is one of the fastest-growing branding agencies in Asia and the United States . In a world of chaos, we bring simplicity and creativity together by our intuitive and data-driven approach, our goal to make real brands! We are Strategic Branding and Advertising Agency. We help brands to grow and spread their wings. We love to brand your startup, luxury brand, real estate brand, or law firm .
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • DiBrand

    DiBrandcertified-flagverified-flag

    5
    (1 review)

    Development & Design

    Recommended
    At DiBrand we help companies to contact their customers through digital solutions, design and development. We are passionate about creating experiences, exploring new technologies and making compelling designs.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Envisionworks

    Envisionworkscertified-flagverified-flag

    (0 review)
    ENVISIONWORKS, located in Miami, Florida is a creative digital marketing & branding firm specializing in luxury boutique hotels and resorts, distinctive lifestyle environments and travel-related experiences.   Our destination marketing clients include some of the most notable luxury hotels, resorts and villas affiliated within the  Leading Hotels of the World  and  Small Luxury Hotels of the World portfolios and highly sought after Caribbean travel destinations.   We work with luxury hospitality and lifestyle brands providing marketing enrichment initiatives which are personalized to articulate each individual story.
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • LLIZO MARKETING

    LLIZO MARKETINGcertified-flagverified-flag

    5
    (1 review)
    Llizo Marketing is a boutique full service marketing agency located in Miami, Fl. Llizo has been helping many small, mid sized and large companies achieve the desired sales goals by providing an array of marketing programs that include: Google AdWords, SEO, Social Media marketing, Content marketing & much more.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Magnetic Mango is a collaborative startup based in Panama City, FL dedicated to providing services that build visibility, awareness, and trust for our clients. We believe that businesses of all sizes – and budgets – should have the opportunity to access unique solutions to their needs. We’re a team of creative marketing, business development specialists, and reputable freelancers who help our clients produce enhanced, more relevant strategies and tactics. We focus on three pillars to live by, work by, and achieve by : These three pillars form the foundation for everything we do on behalf of our clients. We rely on these values to drive mutual success for our company and theirs. Through honesty, loyalty, and respect, companies of all sizes – and budgets – can have the opportunity to access unique solutions to their needs. When clients succeed, we succeed. Honesty As with any successful partnership, we will always be fully transparent with you. Honesty is the first, most essential of our three core pillars. We will let you know up-front what we’re doing, why and how we’re doing it– and how it’ll affect your bottom line. Loyalty We believe that opportunities are everywhere, and will continually explore new ways to resolve our clients’ needs. We maintain our loyalty by asking relevant questions to seek out the best options for our partnerships. Respect Environments, expectations, targets, goals, ideals– and even budgets– can change. We respect our clients and are flexible enough to change with them.
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • PUSH MEDIA

    PUSH MEDIAcertified-flagverified-flag

    (0 review)
    Why Hire Push Media? We will help you sell more of your product or service through our PUSH MEDIA Advertising that allows your brand to be in front of more people so they can listen and buy more from you.   We are a ‘Push Media’ business with an established pedigree in emerging technology, social media management, and web design & development.   The first thing we will do is create a clear brand message so that people will listen and buy more from you.    Sounds easy, doesn´t it?  Well, it is.   But most Fortune 500 firms miss the mark on clearly communicating their message to their clients. We employ an Expected Results Methodology where we guarantee success with every marketing campaign. What does success mean? Success means that we will guarantee to add a number of clients to your existing business using your Website and Marketing Campaigns that work (The number of clients that we will add to your business will be based on the nature of your business).   We are not going to give away our secret formula, however, we will give you the opportunity to schedule a complimentary 15 minute Skype Call with Rommel Pravia, so you can find out for yourself why you need to hire us as your go to Marketing Guru! Here is the calendar link to make finding time easy, click on the link below and follow the instructions.   Invest In Your Business Skype call   See you at the other side!   Rommel Pravia CEO of PUSH MEDIA & Founder of The Mastermind Business & Marketing Course
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • SimpleTiger LLC

    SimpleTiger LLCcertified-flagverified-flag

    5
    (1 review)
    We're a digital marketing agency focused on Search Engine Optimization (SEO) solutions and services for SaaS companies. We offer everything under the SEO umbrella from our expert-led 12 years experience in SEO strategy to Keyword Research, Content Marketing (and strategy), Technical Optimization and Offsite Optimization including link building, PR and influencer marketing. We've driven strong SEO results for companies like Segment and Shopify as well as small, newly funded startups that have to show ROI. Most of our clients see results from SEO when we move from the optimizations of their site and into the production of content and links for their site. We see SEO as a balance of quality content that speaks to your users well combined with quality inbound links supporting the validity of those pieces of content as a metric to the search engines. With the advent of Artificial Intelligence and its adoption by Google more marketers are going to have to run experiments to test what works since the old days of SEO "technical best practices" aren't simply black and white anymore. Sure, some optimization practices are more commonplace and deserve consistency, but in the cases where Titles and META descriptions are concerned for example, testing is required to know what will really help a page rank or not. This is where our team and processes allow for very innovative and fast improvements. We utilize testing and data where necessary and deliver quality content and links on top of that.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • CODE CASTLE

    CODE CASTLEverified-flag

    (0 review)
    Somos una agencia con alto standar de calidad: un Scrum master como project manager, una ingeniero ´Cum laude´ como gerente del equipo de desarrollo y un versátil CEO que maneja cualquier solicitud de lenguaje para sus proyectos, Entre nuestros valores esta la mejora continua lo que nos ubica en un nivel de atención que supera expectativas. Siempre tenemos un valor agregado que ofrecer y nos caracteriza la puntualidad y el analisis a medida de los indicadores de resultados que espera el cliente a invertir en un sistema o en una App. ¡CODE CASTLE, superando expectativas!     We are an agency with a high standard of quality: a Scrum master as a project manager, an engineer 'Cum laude' as manager of the development team and a versatile CEO who handles any request for language for their projects. Among our values ​​is continuous improvement. that places us at a level of attention that exceeds expectations. We always have an added value to offer and we are characterized by punctuality and the analysis tailored to the results indicators that the client expects to invest in a system or an App.   CODE CASTLE, exceeding expectations!
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Webiance

    Webiancecertified-flagverified-flag

    (0 review)
    Award-winner
    Webiance is a Best Digital Marketing And Web Design Agency Worldwide   Webiance is a Best Digital Marketing and Web Design Agency Worldwide offers Digital Marketing Services, Social Media Services, E-commerce Solutions and Website Designing Services   At Webiance, Our primary objective is to help you build and improve your business. As long-established leaders in the online marketing industry, we have the experience and insight to determine the needs of your company and customers, plan and execute processes to align those needs, and ultimately help you attract, engage and convert more customers. Webiance is a Digital marketing and Web Design Agency based out of United States, Canada, United Kingdom and India. We offer Digital Marketing Services, Website Design, E Commerce Solutions, Search Engine Optimization, Pay Per Click, Social Media Marketing and overall Digital Marketing Services. We are catering to our clients based out of USA, Canada, UK, Singapore, Dubai, New Zealand, Australia and other parts of the World.
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • KITRUM

    KITRUMcertified-flagverified-flag

    5
    (1 review)
    We believe it's all about the people. Right people. Since 2016, we’ve been helping CxOs of technology companies world-wide to get access to the most talented software engineers from Ukraine and Poland building software solutions for large enterprises, new ventures, and NGOs in the most risk-proof and cost-effective way possible. With us: - your engineering team will get the specific technical expertise and domain knowledge you need; - you will get access to world class software engineering teams and technology consultants. - your business can scale flexibly. Whether you need a 1 Senior guy for 4 weeks part-time or a team of 5 engineers for 12-24 months, we will help you find fit.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • 3 Pixels Media

    3 Pixels Mediacertified-flagverified-flag

    5
    (1 review)
    3 Pixels Media es un equipo altamente experimentado de creativos, diseñadores y programadores en constante búsqueda de desafíos para impulsar el entorno digital. En los últimos 9 años, hemos entregado con éxito cientos de aplicaciones de vanguardia, lo que nos ha permitido obtener una gran cantidad de conocimientos y experiencia. El equipo de 3 Pixels Media se enorgullece de su filosofía de desarrollo ágil; Una Metodología Flexible que nos ayuda constantemente a cumplir plazos de entrega cortos a la vez que proporciona a nuestros clientes la máxima flexibilidad y rentabilidad.      
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • AVS Cyber

    AVS Cybercertified-flagverified-flag

    (0 review)
    AVS Cyber Web Design – Vietnam Technical Horsepower Backed By  US Market Experts . AVS Cyber is an American branding and design agency based Saigon (Ho Chi Minh City), Vietnam. We love to deliver simple, effective and professional online solutions that help growing businesses and we always keep our core objective – to DELIVER – front and center. Understand the  “Why, When, And How”  Questions At  AVS Cyber , there are NO “formulaic” solutions because no two businesses are exactly the same. We begin by gathering information from you to understand your business goals, its current market position, the competition... everything we can learn to create a successful strategy and action plans that fits  YOUR unique business and YOUR unique goals.
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Juno Digital Development is a leading provider of web development and digital marketing services to a wide variety of companies from Fortune 500 companies to start-ups. We are experts in bringing the highest ROI traffic to our clients' websites. We are experts in SEO. We can manage your PPC/Ad Buy marketing to increase from 200-800% the ROAS of your marketing budget. We are also expert developers and have expertise in HTML, CSS, JavaScript, PHP, Java, Ruby on Rails, Magento, WordPress, and Drupal.
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Intelifaz

    Intelifazverified-flag

    5
    (1 review)

    Have a cup of ☕ while we code 💻 for you 😉

    Award-winner
    Put the A-Team 💪 on your Software Project 💻 Intelifaz is a tight-knit team of highly experienced creatives, technologists, and engineers creating disruptive Digital Customer Experiences web, mobile, and cloud applications. We create immersive dynamic web applications with the technologies that are driving today’s digital experience. Our applications are scalable, easy to maintain, cross-platform enabled, and ready for the API economy. We provide fully-fledged support throughout the whole project’s lifecycle that covers project management, quality assurance, and product design services. Our tech stack is focused on JavaScript (Angular, React, Node.js), and cross-platform frameworks (React Native, Flutter). The team, the code, the schedule, the budget, everything is customizable. We can handle the full project from start to finish or we can augment your internal resources. EXPERTS IN: 🔥Native Languages: Swift, Java 🔥Java Script Frameworks: Angular JS, React Native, React 🔥Code Frameworks: Intelifaz enterprise frameworks 🔥Mean Stack: Express, MongoDB, Node 🔥QA Automation: Python, Selenium Webpack, Protractor,, cucumber, enzyme, unite testing, regression testing, integration testing, data driven testing, smoke testing. FAVOURITE FRAMEWORKS & TOOLS 1️⃣Communication: Slack, Google Meet, Zoom 2️⃣ Project Management: Jira, Trello, GitHub 3️⃣UX Design: Figma, Sketch, Adobe, Miro 4️⃣Cloud Tools: Google, Docker, Amazon, PubNub, Kubernetes, Splunk 5️⃣CD/CI: Ansible, Jenkins. BACKEND INTEGRATION ✔️ Integration Architecture: Point-to-point, vertical, star, service bus ✔️Scope: Consuming customer/partner services. Building customer/partner integration endpoints. Creating middleware for customer solutions ✔️Technologies IBM websphere, firebase, aws lambda, node js, aws iot, java, google cloud platform, Microsoft azure, adobe experience cloud ✔️3rd party tools: microsoft dynamics, OneLogin, Intercom, Zapier Active campaign, Userback, Smartlook, Sprout, Google, Dropbox, Twilio, SSO?SAML, o Auth, Inteliuser Why Choose Us🙌🏻: ➡️Expertise: Our team of seasoned developers, designers, and project managers possess a wealth of knowledge in the software development industry. We stay up-to-date with the latest technologies and best practices to deliver cutting-edge solutions. ➡️Tailored Approach: We understand that every business is unique, and thus, we tailor our solutions to align with your specific goals and requirements. Your success is our primary focus. ➡️Quality and Reliability: At Intelifaz, we prioritize quality and reliability in everything we do. Our rigorous testing processes ensure that our deliverables meet the highest standards of performance and security. ➡️Customer-Centric Philosophy: Your satisfaction is at the heart of our operation. We value open communication, collaboration, and transparency throughout the development journey, ensuring that you’re involved every step of the way. 🛎️ Our team has successfully developed large scale transformative projects for Office Depot, PWC, City Furniture and Tyco and startups like matrproject.com, Stand4, QuantumLeaf and Pienso. We Accelerate Development, Mitigate Risks & Control Costs. Let us be your trusted partner in innovation and growth. Contact us to embark on an exciting journey of transforming your ideas into reality. Have a cup of ☕ while we code 💻for you 😉
    No work in Website Creation
    Active in Florida, United States
    From €5000 for Website Creation
  • Mundrisoft Solutions

    Mundrisoft Solutionsverified-flag

    (0 review)

    Building Next-Gen Enterprises

    Mundrisoft is an IT services and consulting organization focused on building and delivering next-gen technology solutions. We have been delivering cutting-edge solutions for both large and small business. Our services bring innovation and high impact solutions for our clients. We build cutting edge software products right from idea to commissioning for customers across various domains. Our diverse portfolio of IT staff augmentation and digital transformation services include Application Modernization Custom Software Development Custom eLearning for EdTech Headless CMS IT Recruitment Services Offshore Development Solutions QA & Testing Services DevOps & More We work on a wide spectrum of technologies that are built to scale and adhere to latest standards and best practices. Java React Angular .Net Microsoft SharePoint & more. Our Engagement Models Include Fixed Budget Time & Material Staff Augmentation
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Blue Bee Web

    Blue Bee Webcertified-flagverified-flag

    5
    (1 review)

    We help small & medium companies increase sales & leads online with all-in-one digital marketing.

    We help small and medium-sized businesses grow their online sales and leads. Our in-house team offers a full range of digital marketing services, including: • SEO • PPC & Paid Ads • Web Design • Ecommerce Development • Content Marketing & SEO Writing • Social Media Marketing • Email Marketing • Conversion Rate Optimization We don't try to guess what will work for you or make something that might work. Instead, we have tried-and-true digital marketing strategies that work for certain industries, which may include yours. Also, we're not trying to get you to believe us; we want to show you our real results, which you can see on our website. Our in-house team tries to become an extension of your business, which means we always ensure that what we do fits your vision and business goals. As part of our work together, you can always contact us if you have any questions about how things are going. Also, you get a summary report every month that tells you everything you need to know about your online progress. There are no free or discounted trials, and none of our services are free. But we know the risk you take by putting money into your online business. That's why we never start a conversation by pushing a proposal; that's dumb. Instead, we try to give you a chance to learn about our company and for us to learn about yours. It's free, of course! You are welcome to tell us about your business and your online goals. We'll review this information and email you a list of the most important things you need to do right away to help your online business. We also give you a link to book a free digital strategy call with us if you'd like to keep talking. This call is set up so that we can meet in person and for you to ask all of your questions. By the time the call is over, you'll know what you need to do right away to get more leads and sales. We want you to know we're not a "family." We're a team of cohesive experts who love what we do best. We're also always learning and love to combine our experience with new tactics and opportunities. We're not a big corporate agency. We're a team of skilled specialists who want to make some other lives happier & easier too. So, visit our site, request your free digital marketing review by filling out the form and wait for our recommendations for your business! We wish you all the best and hope to have a great partnership soon. Thank you for your time, Vlad and Val, founders of Blue Bee Web.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • B-1 Digital

    B-1 Digitalverified-flag

    (0 review)

    IS YOUR DIGITAL STRATEGY TAKING YOU WHERE YOU WANT TO BE?

    B-1 Digital is a dynamic digital marketing agency with a proven track record of helping businesses thrive in the ever-evolving digital landscape. Our mission is to empower our clients with innovative and data-driven strategies that drive growth, increase visibility, and boost their bottom line. With a team of experts specializing in digital strategy, advertising, social media, and more, we offer comprehensive solutions tailored to the unique needs of each client. Whether you're a startup looking to establish a strong online presence or an established brand seeking to optimize your digital efforts, B-1 Digital is your strategic partner for success. We're here to transform your digital challenges into opportunities and guide you towards sustainable growth in the digital age. Let us unlock the full potential of your online presence and help you achieve your business objectives.
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Cheers Visual Communications

    Cheers Visual Communicationscertified-flagverified-flag

    (0 review)

    Powerful Visual Creations

    Design Agency Specializing in Branding, Web Design, Corporate Photography, Corporate Video, Print Design
    1 work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Laughing Samurai is an Orlando, FL digital creative agency focused on making advertising entertaining, effective and fun. Specializing in brand development, content creation, digital marketing and award-winning website design/development, the Laughing Samurai team puts high priority on quality creative that impacts individuals and their environment.
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • SMBsocial

    SMBsocialcertified-flagverified-flag

    (0 review)
    SMBsocial is an Inbound Marketing software company that provides Digital Presence Solutions to SMB’s, helping them to solve business problems with creative applications and platforms. “We create Digital Ecosystems that enable businesses to extend their reach into the digital world.”
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • On Tap Growth

    On Tap Growthcertified-flagverified-flag

    (0 review)
    We are global Creative Marketing and Advertising agency with the mission to help brands, enterprises and startup companies to connect, engage and retain their potential customers. Unlocking business growth for every entrepreneur. Creative business growth solutions we offers: Design Branding - Creatives Design/Logo Design,  Brochure designs | Digital marketing Banner ads & rich media ads,  Brand Marketing & Communication Solutions Brand Activation & Brand Experience,  Media Planning & BuyingVideo Production and Promotion, Mobile Marketing Strategy | Mobile Advertising Mobile AppsPay Per Click Advertising Online and Offline PR | Contextual Advertising | Social CRM Social Apps and Fan  Social Media Campaigns & Marketing Messaging  | multiple touch points based communications | Integrated marketing Campaigns |Online Presence Enhancement
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • PixelNotch

    PixelNotchcertified-flagverified-flag

    (0 review)
    We are a state of the art design house executing our work from the beautiful cities of Melbourne and Orlando. We professionally design logos and websites to create big brands.We canI work quickly and we have experience using  HTML5 ,  CSS3 ,  PSD to HTML ,  PHP ,  Wordpress ,  Responsive Designs ,  Javascript/jQuery  and various other technologies. Using  WordPress ,  Joomla ,  Opencart  and  Magento  platforms usually for  E-Commerce Websites .
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • We are a web design and marketing firm with offices in Tallahassee, Florida and Mobile, Alabama. We specialize in helping small business create a complete online presence for their business, from developing a strong visual brand to devising effective strategies for social media marketing. Our agency is unique because we are small on purpose! Each of our clients gets personal service from one of the agency's partners, including our cell phone numbers. Because of the relationships we develop with our clients and our deep experience in our field, we are able to achieve outstanding results and help our clients surpass their marketing goals. 
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation
  • Disruptive

    Disruptivecertified-flagverified-flag

    (0 review)
     
    No work in Website Creation
    Active in Florida, United States
    From €1000 for Website Creation

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Begin quickly and without stress your website developement campaign in Florida!

What bureau is the best for my firm?

Picking a bureau is not only long, but it can also be a demanding campaign. Contact thusly Sortlist to fend off any missteps and to accomplish your project expeditiously. Because your firm can trust the skillfulness of our web design companies and their associates in the accounting and the household products industry.

Plans in website developement are necessary for your business. And with our team you will be able to encounter the best company for your website developement assignment in Florida. Please deliver Sortlist your brief, and Sortlist will email your firm asap.

What tasks will a web design company develop?

A sizable index of solutions is put forward by web design companies, for example responsive website creation and website design optimalisation. Thus do not think twice anymore and contact those companies through our platform, and your firm will be able to commence your project directly.

We believe it is safe to say that beginning a operation in responsive website creation or in server configuration without help can eventually develop into a unproductive and pricey failure if your firm does not do it rightly. Don’t overthink it and select a firm in Florida to certify your profit!

Teaming up with our web design companies, a certain gain!

For modest and hefty enterprises is creating a brand-new contact with a collaborator never uncomplicated. So it is of fundamental importance to dig up the most skilled partner, and Sortlist can support your company with this stage! Even the small companies that don't have the resources will, thanks to Sortlist, have the means to spot the useful firm for their forthcoming cooperations.

Sortlist helps you find the best agency in Florida

Sortlist, throughout the years, developed into a master in matchmaking. Marketers who require to encounter the peerless digital agency for their activity in website developement will now be able to do so, with a five-star, valuable and free service.