The 10 Best SEO Agencies in Florida (2024)

Best SEO Agencies in Florida

Featured providers

  • UAATEAM LLC

    UAATEAM LLCcertified-flagverified-flagfeatured-flag

    4.9
    (32 reviews)

    🏆 Best rates for Sortlist users 🏆

    Recommended
    Award-winner
    We offer digital marketing services to firms who wish to maximize their internet marketing efforts. Based on your project and objectives, we can provide complicated or simple consulting services. ⭐️ SEM (PPC) management - your advertisements will be displayed above the organic search results in most major web search engines based on the keywords you specify. ⭐️ SEO management - we will optimize your website or application to rank higher in search engine results. ⭐️ Email marketing - we'll enhance your brand's revenue and user engagement. Promotional emails, welcome series, and cart abandonment ⭐️ Social Media Marketing (SMM) - we'll advertise your company on social networks and enhance audience interaction. We will collaborate with influencers to increase brand awareness and sales. ⭐️ CRO (Conversion Rate Optimization) - we will analyze your data and raise the conversion rate of your website or advertising campaigns without increasing your budget. Our company is a Google Premier Partner and Meta Marketing Partner. We are also partners with such services as Shopify, Klavuyo, Mailchimp, and TikTok, indicating that our qualifications are of the greatest level. We are experts in the following: Pay per click: Google Ads, BingAds, Facebook/Instagram ads, TikTok advertising, Pinterest advertising, Twitter advertising, Google Merchant Center, Programmatic, Quora ads, Yelp, Amazon ads. SEO : on-page SEO, off-page SEO, local SEO, technical SEO, Linkbuilding, PBN building. Social Media : influencers marketing, Instagram, Facebook, Twitter, TikTok, Linkedin, Pinterest, Social media strategy, social media content, UGC. Email marketing : automated flows, promo campaigns, Klaviyo, Mailchimp, Sendgrid, Sendpulse, Omnisend. Conversion Rate Optimization: Google Optimize, Google Analytics, heatmaps, UI/UX optimization, A/B testing. Contact us immediately to discuss your online advertising idea.
    6 works in SEO
    Active in Florida, United States
    From €650 for SEO
  • Teranga Digital Marketing

    Teranga Digital Marketingcertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    SEO-only agency with an ROI-focused approach to SEO.

    Recommended
    We are a boutique marketing agency only offering one service: SEO. We help B2B businesses rank number one on Google and generate mind-blowing ROI with targeted SEO campaigns. No Facebook ads, no social media management, no YouTube, no PPC, and no email marketing. Just SEO, and we’re really good at it. Why? Because we exist to see our clients grow and firmly believe that SEO is the best long-term strategy to sustainably grow your business year on year. The best bit? We have a performance-based pricing model and work with clear deliverables. Meaning, you will get results as we build your SEO machine.. Want to learn more? Reach out!
    7 works in SEO
    Active in Florida, United States
    From €1500 for SEO
  • Solvid

    Solvidcertified-flagverified-flagfeatured-flag

    (0 review)

    We Skyrocket Businesses Online

    Award-winner
    Established in 2015, Solvid is a creative SEO, Guest Blogging, Copywriting, Content Marketing and Digital PR agency based in the heart of London, United Kingdom. We are proud of what we do. We get butterflies by helping businesses succeed online. We use effective search engine optimisation, guest blogging, digital PR, copywriting, content marketing and link-building efforts to catapult your rankings, drive organic traffic and generate sales. We’ve worked with some of the most exciting brands in many different niches to create meaningful, data-driven SEO results. Solvid is about much more than just getting your business noticed online. Our experienced team of professionals work tirelessly to win you more customers, increase search traffic and generate more conversions. Having worked with notable clients like Freedom24, The Open University, Hostinger, MetaTrader 5, Finteza and Kucoin, we've helped numerous businesses prosper online, generate organic traffic and increase conversions. Our clients have been featured in some of the most prominent publications in the world, including Forbes, Business Insider, Nasdaq, TechRadar, U.S.News, Yahoo News, Mashable, Hubspot, and many more. Our services include: SEO (Search Engine Optimisation) Guest Posting and Blogger Outreach Content Marketing Copywriting Digital PR SEO Audits Link Building We specialise in the following industries: Fintech SaaS Crypto Marketing Law/Legal Insurance eCommerce B2B Finance and Investing Health Tech Retail Get in touch to start propelling your business to the top of search engine results.
    3 works in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Web Design Glory

    Web Design Glorycertified-flagverified-flagfeatured-flag

    4.9
    (33 reviews)

    "Rising Brands for Digital Glory!"

    Recommended
    Award-winner
    Web Design Glory is a professional web design and development agency that offers a wide range of services to help businesses establish a strong online presence. Our team of experienced designers and developers works closely with clients to understand their unique needs and create customized solutions that meet their specific requirements. Our services include Website Design, Web Development, Mobile Application, Branding Solutions, Digital Marketing, Domain & Hosting, Video Animation & Content Creation. We specialize in creating modern, responsive websites optimized for search engines and providing a great user experience. Our web development services include e-commerce solutions, content management systems, and custom web applications. At Web Design Glory, we are dedicated to providing high-quality services that deliver results. Contact us today to learn more about how we can help your business succeed online.
    2 works in SEO
    Active in Florida, United States
    From €186 for SEO

Best SEO Agencies in Florida

Sort by
  • LinkingAds

    LinkingAdsverified-flagfeatured-flag

    4.6
    (1 review)
    Recommended
    Award-winner
    We’re focused on providing our clients with optimal digital marketing solutions that always result in new generated leads online. Our team is made of carefully picked go-getters who are ready to help you and your business rise above the competition in the search results. What makes us different from all the other agencies is that we are results driven, we are also perfectionists so what ever we do we will make sure it's perfect. Our real-time transparency reporting will always let you know what's going on. 
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • wdmarketingdigital

    wdmarketingdigitalverified-flagfeatured-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    1 work in SEO
    Active in Florida, United States
    From €400 for SEO
  • 3 Pixels Media

    3 Pixels Mediacertified-flagverified-flagfeatured-flag

    5
    (1 review)
    3 Pixels Media es un equipo altamente experimentado de creativos, diseñadores y programadores en constante búsqueda de desafíos para impulsar el entorno digital. En los últimos 9 años, hemos entregado con éxito cientos de aplicaciones de vanguardia, lo que nos ha permitido obtener una gran cantidad de conocimientos y experiencia. El equipo de 3 Pixels Media se enorgullece de su filosofía de desarrollo ágil; Una Metodología Flexible que nos ayuda constantemente a cumplir plazos de entrega cortos a la vez que proporciona a nuestros clientes la máxima flexibilidad y rentabilidad.      
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Blue Bee Web

    Blue Bee Webcertified-flagverified-flagfeatured-flag

    5
    (1 review)

    We help small & medium companies increase sales & leads online with all-in-one digital marketing.

    We help small and medium-sized businesses grow their online sales and leads. Our in-house team offers a full range of digital marketing services, including: • SEO • PPC & Paid Ads • Web Design • Ecommerce Development • Content Marketing & SEO Writing • Social Media Marketing • Email Marketing • Conversion Rate Optimization We don't try to guess what will work for you or make something that might work. Instead, we have tried-and-true digital marketing strategies that work for certain industries, which may include yours. Also, we're not trying to get you to believe us; we want to show you our real results, which you can see on our website. Our in-house team tries to become an extension of your business, which means we always ensure that what we do fits your vision and business goals. As part of our work together, you can always contact us if you have any questions about how things are going. Also, you get a summary report every month that tells you everything you need to know about your online progress. There are no free or discounted trials, and none of our services are free. But we know the risk you take by putting money into your online business. That's why we never start a conversation by pushing a proposal; that's dumb. Instead, we try to give you a chance to learn about our company and for us to learn about yours. It's free, of course! You are welcome to tell us about your business and your online goals. We'll review this information and email you a list of the most important things you need to do right away to help your online business. We also give you a link to book a free digital strategy call with us if you'd like to keep talking. This call is set up so that we can meet in person and for you to ask all of your questions. By the time the call is over, you'll know what you need to do right away to get more leads and sales. We want you to know we're not a "family." We're a team of cohesive experts who love what we do best. We're also always learning and love to combine our experience with new tactics and opportunities. We're not a big corporate agency. We're a team of skilled specialists who want to make some other lives happier & easier too. So, visit our site, request your free digital marketing review by filling out the form and wait for our recommendations for your business! We wish you all the best and hope to have a great partnership soon. Thank you for your time, Vlad and Val, founders of Blue Bee Web.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Magnetic Mango is a collaborative startup based in Panama City, FL dedicated to providing services that build visibility, awareness, and trust for our clients. We believe that businesses of all sizes – and budgets – should have the opportunity to access unique solutions to their needs. We’re a team of creative marketing, business development specialists, and reputable freelancers who help our clients produce enhanced, more relevant strategies and tactics. We focus on three pillars to live by, work by, and achieve by : These three pillars form the foundation for everything we do on behalf of our clients. We rely on these values to drive mutual success for our company and theirs. Through honesty, loyalty, and respect, companies of all sizes – and budgets – can have the opportunity to access unique solutions to their needs. When clients succeed, we succeed. Honesty As with any successful partnership, we will always be fully transparent with you. Honesty is the first, most essential of our three core pillars. We will let you know up-front what we’re doing, why and how we’re doing it– and how it’ll affect your bottom line. Loyalty We believe that opportunities are everywhere, and will continually explore new ways to resolve our clients’ needs. We maintain our loyalty by asking relevant questions to seek out the best options for our partnerships. Respect Environments, expectations, targets, goals, ideals– and even budgets– can change. We respect our clients and are flexible enough to change with them.
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Webiance

    Webiancecertified-flagverified-flag

    (0 review)
    Award-winner
    Webiance is a Best Digital Marketing And Web Design Agency Worldwide   Webiance is a Best Digital Marketing and Web Design Agency Worldwide offers Digital Marketing Services, Social Media Services, E-commerce Solutions and Website Designing Services   At Webiance, Our primary objective is to help you build and improve your business. As long-established leaders in the online marketing industry, we have the experience and insight to determine the needs of your company and customers, plan and execute processes to align those needs, and ultimately help you attract, engage and convert more customers. Webiance is a Digital marketing and Web Design Agency based out of United States, Canada, United Kingdom and India. We offer Digital Marketing Services, Website Design, E Commerce Solutions, Search Engine Optimization, Pay Per Click, Social Media Marketing and overall Digital Marketing Services. We are catering to our clients based out of USA, Canada, UK, Singapore, Dubai, New Zealand, Australia and other parts of the World.
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • PUSH MEDIA

    PUSH MEDIAverified-flag

    (0 review)
    Award-winner
    What we do   We have a wide range of experience, expertise and tools to create and implement your campaigns, from web development, ecommerce, social media, to carefully curating awesome content to optimising it online with our great SEO and PPC powers, not to mention exceptional social media. The backbone to our strategic process is the data-backed content we create, which has been endlessly researched so it’s the best and most relevant it can be. Our team works hard to ensure that your content is served up like a big juicy steak (vegetarians also welcome), and we aren’t finished until we’ve served a delicious three-course meal that leaves you satisfied.   How We Do It   To get under the skin of your content, we match your project with the team members best-suited to it. We may be in digital marketing but we work human to human, so we’ll work closely with you to really get under the skin of your goals. You’ll notice that we don’t like to overcomplicate things – so we only use technical jargon if we’re going for a triple-word score in Scrabble.   Help Us Help You   Here at PUSH MEDIA we appreciate your goals and understand the confusing and crazy world of digital marketing, meaning we can guide you through the best avenue for your online objectives. If you want to succeed online and you’re ready to explore the options available to you, get in touch! We’d love to hear from you!
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Red Class aims to break down technological barriers with customized and affordable solutions, helping your business scale. With security solutions from infrastructure to end user protection, we will accelerate businesses towards hardening their digital assets ready for market breaking presence. When it comes to gaining relations with customers, don't just make an online presence; dominate in today's constant changing industry with our marketing ecosystem. Services include but not limited to:  Hardware Sales Cloud Services Online Marketing SEO  Content Marketing Networking VoIP Finding the right solutions for the right challenges can be confusing. At Red Class, we seek to help businesses make the right investments through our expert IT consulting and access to a wide range of technology services. Our customer's one-on-one experience is detail driven. We follow with fitting solutions and constant result driven improvements.    
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • At EyeQuest Digital, we help businesses maximize the impact of every dollar they spend on digital marketing. We use a vast array of services to create a plan that is unique to the needs of each customer and is structured to achieve their specific goals. The foundation of our success is our digital marketing master plan, which we have developed over the past 11 years of serving our customers.
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Juno Digital Development is a leading provider of web development and digital marketing services to a wide variety of companies from Fortune 500 companies to start-ups. We are experts in bringing the highest ROI traffic to our clients' websites. We are experts in SEO. We can manage your PPC/Ad Buy marketing to increase from 200-800% the ROAS of your marketing budget. We are also expert developers and have expertise in HTML, CSS, JavaScript, PHP, Java, Ruby on Rails, Magento, WordPress, and Drupal.
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Edbrig

    Edbrigcertified-flagverified-flag

    5
    (1 review)
    Recommended
    We are an independent branding and advertising agency , who helps brands to stand out with the help of our branding and advertising services. Edbrig is one of the fastest-growing branding agencies in Asia and the United States . In a world of chaos, we bring simplicity and creativity together by our intuitive and data-driven approach, our goal to make real brands! We are Strategic Branding and Advertising Agency. We help brands to grow and spread their wings. We love to brand your startup, luxury brand, real estate brand, or law firm .
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Sunraise Solutions US LLC

    Sunraise Solutions US LLCcertified-flagverified-flag

    (0 review)

    360° DIGITAL MARKETING GAME-CHANGER

    1 work in SEO
    Active in Florida, United States
    From €600 for SEO
  • Web Traffic Strategist Inc.

    Web Traffic Strategist Inc.certified-flagverified-flag

    (0 review)

    Web Traffic Strategist main focus is on leads, combining our SEM your (ROI) will grow every month!

    Award-winner
    Web Traffic Strategist's name was picked out for a reason. As we understand sales in the SEO services field we noticed the promises some agencies made when pitching to business owners. They offer rankings that did not bring the right users to take action that would lead to sales. Most agencies do not focus on what a small to medium business needs to stay afloat or grow, which is sales! Without a well online marketing strategy most business fail. We focus on (ROI) and are selective with companies we work with because good results such as leads depends on how visible you are, brand authority, and other factors your business has or lacks. T hat's why you need an online consultation explaining your strenghts and weakness in your industry, call us to understand where you stand among your competitors and what and how long is going to take to see $$$$$$$ your return on investment!
    1 work in SEO
    Active in Florida, United States
    From €3000 for SEO
  • Laughing Samurai is an Orlando, FL digital creative agency focused on making advertising entertaining, effective and fun. Specializing in brand development, content creation, digital marketing and award-winning website design/development, the Laughing Samurai team puts high priority on quality creative that impacts individuals and their environment.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Creative Mindworks, a Miami Florida based internationally ranked integrated marketing and advertising firm—solutions driven and Thinking Fresh Daily! For 25 years, our collaborative of inspired individuals has created marketing ideas that deliver. For us, it’s not about how many clients we secure, it’s about how effectively we solve their problems. We achieve results through strategic marketing solutions that are always compelling and fresh. Whether it’s branding, print collateral, traditional advertising or online, we tailor the services we provide to the unique needs of each valued client. Our team understands that great advertising must be accompanied by great results. That’s why we do more than offer marketing services. We create solutions.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Jasmine Sandler

    Jasmine Sandlercertified-flagverified-flag

    (0 review)
    Jasmine Sandler is an awarded Digital Marketing Strategist and Consultant with over 100 successful SEO and Social Media client engagements completed.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • The Original TraDigital Agency - Moore and Scarry Advertising is the nation's largest Tier-3 automotive advertising agency. With 68 employees in Cape Coral, Florida and 30 in Denver, Colorado, our clients enjoy local support with national impact. Boasting 21 Telly Awards, numerous ADDYs and AVAs, our full-service advertising and audiovisual production capabilities are industry proven. We currently represent more than 300 automobile dealers across the country, including dealer groups appearing in the Fortune 500 and Automotive News Top 125. Our portfolio also includes two award-winning digital and social media subsidiaries: DyGen and Sparq.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • On Tap Growth

    On Tap Growthcertified-flagverified-flag

    (0 review)
    We are global Creative Marketing and Advertising agency with the mission to help brands, enterprises and startup companies to connect, engage and retain their potential customers. Unlocking business growth for every entrepreneur. Creative business growth solutions we offers: Design Branding - Creatives Design/Logo Design,  Brochure designs | Digital marketing Banner ads & rich media ads,  Brand Marketing & Communication Solutions Brand Activation & Brand Experience,  Media Planning & BuyingVideo Production and Promotion, Mobile Marketing Strategy | Mobile Advertising Mobile AppsPay Per Click Advertising Online and Offline PR | Contextual Advertising | Social CRM Social Apps and Fan  Social Media Campaigns & Marketing Messaging  | multiple touch points based communications | Integrated marketing Campaigns |Online Presence Enhancement
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Internet Marketing Agency in Fort Lauderdale, Florida. A top Fort Lauderdale SEO and digital marketing company.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Outsmart Labs

    Outsmart Labscertified-flagverified-flag

    (0 review)
    Outsmart Labs is a strategic digital agency with a passion for helping brands meet their business goals with ground-breaking tactics.  Our clients want to grow, scale, and position themselves as leaders in their space. For that reason, innovation and experimentation are crucial to our promise.   Our mission : Develop digital strategies and innovative solutions to achieve our clients online business goals as efficiently and seamlessly as possible. Together, we all share one mission: forward movement.   Our Capabilities :   - Digital Agency  - Social Media Management: Facebook, Twitter, Google+, Instagram, Yelp, Foursquare and many more.   - Content Marketing: Blog articles, Newsletters, Webinars   - Affiliate Marketing Management   - Paid Advertising: SEM/ SEO/ Adwords campaigns   - Website Development   - Integrated Marketing Strategies  We understand and value the importance of small businesses and are willing to work with budgets of all sizes! Don't hesitate to contact us at needhelp@outsmartlabs.com  For more information on the impact of social media on businesses and how you can increase sales simply by being online, check out our blog http://outsmartlabs.com/blog/
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Fairhead Creative is a leading web design company based in Florida and serves web services like UX website design and development, SEO, graphic design, branding , etc at Tampa, Clearwater, St. Pete, Miami, Orlando and Florida . We have got many years of industry experience and passion for helping businesses better and serve their customers online. We love making great websites for our customers. Our developer has many years of experience in UX website development. Do you have any questions for our web services? Contact our phone support team @ 1-813-644-9944. 
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  •   As India’s premium business process management services provider, Tata Business Support Services is a wholly owned subsidiary of Tata Sons, the holding company of the 142 years old Tata Group – India’s most reputed brand. Inspiring trust and un-complicating business transformations since 2004, Tata BSS is driven by the value of simplicity and serve companies that want to increase their customer base, retain high value customers, protect their brand reputation and become more efficient. Business Info :  With state-of-the-art facilities across 19 delivery centres in 15 locations & powered by Over 11000 PILOTS (Preparing Innovative Leaders of Tomorrow), Tata Business Support Services provides customer lifecycle management, digital marketing, Business analytics & research, HR/payroll, procurement and IT services for a growing community of 46+ industry leading customers spread across USA, Europe and Asia. 
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Award-winner
    S&G is an award-winning content marketing agency that creates branded content experiences for companies who want to stand out from competitors, transform into thought leaders, and connect with customers and clients in a way that drives bottom line results. Our mission is simple: we help brands communicate with their customers through engaging, authentic content campaigns. Our team of content marketing experts come from nationally recognized newspapers, top-tier magazines, Fortune 500 powerhouses, and cutting-edge tech companies.  We were voted as one of the top 3 content marketing agencies in NYC by Clutch. And we've been named one of the top 50 global content marketing agencies four years in a row by The Content Marketing Institute. We believe: - That everyone has a story, and good storytelling can capture the imagination - That marketing buzzwords come and go, but great content is always great  - That no industry has to be dry, boring, or resort to tired cliches - That creativity and results go hand-in-hand  
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • vervelogic

    vervelogiccertified-flagverified-flag

    (0 review)
    With the motive of bringing a positive change in the business world, we came into existence in 2011. Since our inception, we have managed to establish the online presence of a plethora of brands. Our team of specialists takes the utmost care of our clients’ demands and needs. With the help of our knowledgeable and skilful professionals, we have assisted many businesses to achieve their primary objectives. Our services are extended to India as well as abroad. Other than these basic services, we also offer game development and content creation services. Whether you are an established or a budding brand, we have ideal solutions to your persisting business problems. In the forthcoming years, we look forward to serving our valuable clients in better and realistic ways. Our innovation and creativity are two imperative assets of our agency. Services Offered: - Brand Designing - Website Designing & Development - Mobile Application Development (Android/IOS) - Digital Marketing Services (SEO, SMO & PPC) Verve Logic aims to plan an end to end IT journey of their clients right from the initial most stage of company inception which is brand designing which includes Logo designing and other office & marketing collaterals for the brand. Once the clients get to taste the efficiency, creativity & professionalism of our company at this stage, we enter into a long term relationship with them for planning their IT journey. We operate in a completely unique way amongst our peers. All of our staff members (600+) have passed through our rigorous training programmes. They are trained in specific technologies and we take their comprehensive English language and understanding skills a step further. As we operate in as a matrix organisation each technology group is set up to support others so we can pool our resources across multiple technologies to provide a complete development service. We pride ourselves in having a large number of staff employed by our company (not subcontractors) who tend to stay with us as we are a well respected and successful organisation. We have many clients the world over including the Indian Government. Our employees have technology training and we have an employed English teacher to raise and maintain our employees written and spoken English. Our Agile project methodology means that we will be looking to our clients to confirm our work as we move on to the next task. This eliminates doubt so that clients understand the development process and any challenges that need to be faced and overcome. There has been a perception recently that projects under the more rigid and traditional project management methodologies are suffering from a lack of quality. We have been working with our partners at the well known IT Consultancy at Gartner® to refine our own processes so that we can always deliver high quality web and mobile development projects that provide added business benefits to your organisation.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • ROI Amplified

    ROI Amplifiedcertified-flagverified-flag

    (0 review)
    ROI Amplified is a full-service Google Partner agency that specializes in custom digital marketing solutions. From digital advertising to marketing automation, ROI Amplified builds a custom marketing solution based on data and internal processes. Call to start your profitability analysis today!
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • M & M Multimedia LLC is a full service media and marketing company located in Fort Myers, Florida. Specializing in content marketing to boost your SEO, SEM, PPC, Social Media, Mobile, and Email Marketing. Whether you need video production with an edge, web development that distinguishes, or interactive design to engage users, our creative team can give your customers the content they crave. Once your media content is produced we help ensure your message reaches your target audience. Our media planning expertise encompasses traditional advertising and marketing channels through T.V. commercials, radio ads, and print, plus we also excel in the complex realms of online marketing. All this means less cost for you since there no need to mark-up subcontracted work like some of our competitors, and your brand message will stay consistent throughout various marketing channels. Contact us today to discuss your next exciting project. We guarantee you will love our work and like working with our team.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • When you have a great business, you would want a great marketing agency to match with it.   That is why Reacher Digital Solutions was formed. Rooted with the capability to see the bigger picture. We help everyday businesses big or small take the big leap to take-off and achieve their goals. With the new era of marketing here, we can utilize multiple digital marketing strategies to pinpoint exactly what to use and what will be most beneficial for your business.   We research, strategize, take action, and prove with the results.   No B.S - Straight to the point.     Its time to take part in this partnership and expand your horizons for you and your business.   The perfect terminal for your marketing, domestic or international.   We provide multiple services that can be a la carte or packaged: -Social Media Marketing -Web Design & Hosting -Press releases -Pay Per Click -Search Engine Optimization -Photography   -App Development   Just to name a few     There is no secret sauce to marketing. Only consistent implementation of marketing tactics with the results.   Knowledge is power - power is knowledge   We have done the research and studying and have been certified to prove our understandings.   True Partners - Not just another agency. You won’t be pushed aside. We know success can only be achieved if there is one-on-one communication.  
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • 5th Element Marketing Group, based in West Palm Beach, Florida is a foremost web design agency in Florida that also offers a wide range of digital marketing solutions. From making beautiful and responsive websites to create an identity for your brands, 5th Element Marketing Group is a name thousands of business owner’s trust on. The company holds a team of experienced and dynamic professionals who specialize in delivering amazing design solutions with keeping clients’ expectations as a priority. So if you were looking for a reliable web design company West Palm Beach, Florida, 5th Element Marketing Group is a name you can trust and rely on!
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • AVS Cyber

    AVS Cybercertified-flagverified-flag

    (0 review)
    AVS Cyber Web Design – Vietnam Technical Horsepower Backed By  US Market Experts . AVS Cyber is an American branding and design agency based Saigon (Ho Chi Minh City), Vietnam. We love to deliver simple, effective and professional online solutions that help growing businesses and we always keep our core objective – to DELIVER – front and center. Understand the  “Why, When, And How”  Questions At  AVS Cyber , there are NO “formulaic” solutions because no two businesses are exactly the same. We begin by gathering information from you to understand your business goals, its current market position, the competition... everything we can learn to create a successful strategy and action plans that fits  YOUR unique business and YOUR unique goals.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Titan SEO Group

    Titan SEO Groupcertified-flagverified-flag

    (0 review)
    Titan SEO Group is an award-winning web design and digital marketing agency specializing in SEO, PPC and digital marketing. We deliver tangible results by working closely with clients to devise and implement an online marketing strategy that generates attention and revenue. We can help you increase the number of qualified visitors to your website and improve your conversion rate. Affordable SEO Services Want to learn how to get your website on Google? Partner with the top SEO experts to see results fast and achieve SEO rankings for your site. More monthly traffic means more conversions and greater profits. We promise high ROI, our services pay for themselves.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • REM MARKETING

    REM MARKETINGcertified-flagverified-flag

    (0 review)

    Better strategies, better results.

    We are an international digital marketing agency located in the United States and Chile, countries in which we have developed strategies for various industries and markets. We are distinguished by agile thinking, a work culture that we have successfully implemented in our methodology, achieving excellent results in all the projects we manage.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Award-winner
    DigitlHaus is an award winning, full-service, BigCommerce, Shopify Plus and Magento Commerce agency. From concept to conversion, we create B2B and DTC brand experiences that connect with the consumer and convert.
    1 work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Soy Leo de MobAppCreator y estamos más que felices porque lanzamos un upgrade de nuestra plataforma. MobAppCreator es la solución más avanzada para crear aplicaciones móviles nativa, incluye content management actualizaciones automáticas y mucho más! Tenemos una excelente propuesta marca blanca para agencias y resellers. Si están interesados en complementar su cartera de productos, podemos coordinar una meet para presentarles la plataforma y evacuar dudas. No dudes en escribirme. Saludos Leo Pasquini leo@mobappcreator.com https://MobAppCreator.com
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • TechNerds Inc

    TechNerds Incverified-flag

    (0 review)
      From web and mobile app design & development to online marketing campaigns, our smart solutions help brands and businesses increase visibility, engagement, and revenue. Starting with a simple discovery call to creating strategic action plans, we work as a team to design, develop, and deploy websites and mobile apps into the market. At TechNerds, we provide you access to our collaborative platform where you can manage your projects, create tasks, and schedule meetings with your dedicated team. No more gambling with freelancers and agencies, saving you time and money.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • First established in 1997, Ventura Web Design & Marketing is a full service digital agency specializing in website design and development, as well as e-commerce support. We can do anything from building new online stores and websites, redesigning or optimizing current websites or help with growing your business/ finding you new customers. We work with platforms such as Shopify, Miva, Bigcommerce, Woo commerce, 3dcart and WordPress. We are proud to offer and have extensive experience in a wide range of services. We have a strong and diverse portfolio having serviced several different types of websites including: Doctors, Lawyers, Retail Stores, Wholesalers / Manufacturers and apartment home websites. Our goal is to see all of our clients succeed and we work diligently to ensure that!
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Seller’s Bay, LLC has locations in Orlando and Lake Mary, Florida USA but we accept projects worldwide. We are a Google AdWords certified partner and have been building and marketing websites since 1998. Seller’s Bay provides a range of web design and online marketing services to ensure your business gets more sales, customers, leads and brand recognition.   We have a highly skilled team of web designers, online marketing experts and web developers to ensure your project is completed as efficiently as possible and to the highest standards.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Websults LLC

    Websults LLCcertified-flagverified-flag

    (0 review)
    Websults is a web design, SEO, and digital marketing agency that offers custom website development, innovative optimization, and digital marketing solutions. We deliver results because we approach web projects from a business perspective with the goal of providing our clients with a distinct competitive advantage in their industry. We work with clients in Nashville, Tennessee, Tampa, Florida, central Texas and around the world on website and digital marketing consulting projects. We have delivered custom-tailored web solutions for numerous clients including Central Parking, Vanderbilt University, Kotobukiya, Diné College, JANUS Displays, NYJTL, and WASCO. Contact us for a free consultation and see what we can do for your business.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Market Media Connect Inc. aims to deliver all-out digital marketing solutions to corporations, niches, and investors. With experts that have decades of experience combined, Market Media Connect Inc. is unique in its nature as the sole agency that works on a deep-rooted and personal level with all its clients. Market Media Connect Inc. provides digital solutions to many industries like Investor Relations, Analytical Reporting, and even to Doctors and Lawyers. Bridge the gap between innovation and success with Market Media Connect Inc.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • At helium creative, We provide branding + design studio creating dynamic, personified brands for clients who value an in-depth, collaborative approach when it comes to developing their identity, web design & development, marketing strategy + collateral, and digital + print materials. Since our incarnation 18 years ago, helium creative has been dedicated to delivering a higher creative standard through superior service and attention to detail. This approach has led to successful, award-winning designs and long-standing relationships. Unwavering devotion to an immersive process of listening, discovery, creation, engagement, and storytelling enables helium to identify the fundamental idea for why a brand exists and communicate its distinctive experience through great design. helium creative has launched helium reality, a new division specializing in augmented reality and 3D rendering services. With this new division, we can now make what was once a dream, into a reality. About Owner = Christopher is involved with every project his company takes on. He has instilled the hands-on, caring approach that is helium creative and provides the leadership that separates our business strategy and client relationships from other agencies. He leads with his head but follows his heart. Christopher is the captain of our ship, ensuring that helium stays on the rise.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • WeDoWebApps LLC

    WeDoWebApps LLCcertified-flagverified-flag

    (0 review)

    ECommerce Website Development, Mobile App Development

    WeDoWebApps LLC is a leading IT company engaged in providing prominent solutions for ECommerce Website Development, Mobile App Development, UI/UX and Digital Marketing to its globally spread clients.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Bipper Media Web Design & SEO

    Bipper Media Web Design & SEOcertified-flagverified-flag

    (0 review)

    Website Designer

    Bipper Media builds superior websites that deliver increased traffic, leads, and sales for both local and small business, and large enterprise clients. We deliver powerful internet marketing and SEO services to clients throughout the world, right here from our offices in Athens, Georgia and Tarpon Springs, Florida. We provide powerful websites and search engine optimization to clients large and small. Bipper Media has been providing cutting edge internet marketing solutions since early 2000 and has worked with clients from small local markets and large corporations. Address: 23 E Tarpon Ave, Ste 16, Tarpon Springs, FL 34689, USA Phone: 727-940-3902
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Eagle Vision Marketing

    Eagle Vision Marketingcertified-flagverified-flag

    (0 review)

    Digital Marketing in Sarasota, FL

    A digital marketing agency utilizing research driven strategies, while providing concierge level customer service. Phone: 941-216-5250
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Phone Number: +1 321-261-0881 Rank higher on Google searches for your services! Cerebral Analytics® Digital Marketing is "Data-Driven". We specialize in small business Local SEO, WordPress(Website) Design, and Google Analytics. Ready to compete for more online traffic? Get your free SEO audit today!
    No work in SEO
    Active in Florida, United States
    No budget for SEO
  • Keyideas Infotech Private Limited

    Keyideas Infotech Private Limitedcertified-flagverified-flag

    (0 review)

    Top Web Design and Software Development Company

    Award-winner
    In 2007, our journey began as a modest software development agency. Since then, we've continuously progressed, evolving into a comprehensive provider of top-tier website design and development services. Our expertise spans design, mobile apps, e-commerce websites, UI/UX, and marketing. At Keyideas, we take immense pride in our capability to deliver tailored web excellence that caters to the distinct requirements of top industries. Our comprehensive suite of web and mobile app development services seamlessly integrates innovation and expertise, offering bespoke solutions that empower businesses across a wide range of sectors.
    No work in SEO
    Active in Florida, United States
    From €3000 for SEO
  • All Seasons Service Network | 89 East Blount Street #A Pensacola, FL 32501 | (850) 434-0384 | https://www.allseasonsnow.com/
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Sigma Solve Inc

    Sigma Solve Inccertified-flagverified-flag

    (0 review)

    Sigma Solve is a firm specializing in technology consulting and software development

    Sigma Solve is a US based software development company providing businesses worldwide with custom software solutions in technologies such as eCommerce - nopCommerce, Liferay, Magento, Shopify, Custom Software development with .NET, Java, Ruby on Rails, Python, Php CRM solutions for Salesforce & Mobile Application development.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Coleman Intellect

    Coleman Intellectcertified-flagverified-flag

    (0 review)

    Content for Change. Content for The Culture.

    Coleman Intellect is a digital marketing and creative agency that helps tell the visual story of organizations’ diverse dreams. A Black-owned, Tampa-based organization dedicated to making a difference through innovative content that addresses the complex social world around us.
    No work in SEO
    Active in Florida, United States
    No budget for SEO
  • Agencia Digital AMD

    Agencia Digital AMDcertified-flagverified-flag

    (0 review)

    Como agencia digital líder en el mercado, innovamos, escuchamos, entendemos, investigamos y analizam

    Como agencia digital líder en el mercado, innovamos, escuchamos, entendemos, investigamos y analizamos con métodos y herramientas. Combinamos creatividad y conocimiento técnico. Somos un puente ideal de apoyo entre nuestros clientes y su público objetivo, para llegar así con la mayor eficiencia posible.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO
  • Ndimension Labs

    Ndimension Labscertified-flagverified-flag

    (0 review)
    Ndimension Labs helps re-imaging innovation by offering customized solutions in mobile & web apps, software and digital solutions. Revamping your digital solution capabilities with features that brings your business to the forefront. We help organizations transform data into real-world intelligence.
    No work in SEO
    Active in Florida, United States
    From €1000 for SEO

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Let’s go, launch immediately your campaign in Florida!

an SEO agency, a real power for your operation.

Anyway what is free from doubt is that a skilled company will grant your firm the skillful vision that your firm desires, together with special tips for raising the profits of your action. This will thereupon lead to an finer dispensing of your days. Contributing, eventually, to an increase in your capacity.

Begin projects in SEO in Florida.

A vast panel of solutions is offered by SEO agencies, for instance search engine marketing and technical and content SEO optimalisation. Thus do not hold off anymore and reach out to those agencies through our software, and your firm will be able to begin your task promptly.

Consequently, if your company requires to achieve a operation in search engine marketing, SEO consulting or even in technical and content SEO optimalisation, then your firm doesn’t have to misuse valuable time looking for a master in Florida. Because at Sortlist we will be able to aid you meet the right agency and you will surely see that a project in SEO will have a undeniable imprint on your returns.

The cooperation with one of our professional associates in SEO can start at once! This is totally conceivable considering Sortlist is at your disposal and would be happy to help your company with any of your doubts. So if your company would love extra guidance, you can rely on our company no matter when.

Which company is the most compatible for my business?

We, at Sortlist, believe in love at first sight between a business and an SEO agency. Thus we will, bearing in mind your activity, prepare a listing of all SEO agencies that will satisfy all your demands.

Sortlist helps you find the best agency in Florida

Looking for a collaborator in the neighborhood of Florida for your forthcoming communication activity? Do not waste any time and contact us. Since SEO agencies will be a colossal support for your search engine marketing or your SEO consulting activities.