The 10 Best Ecommerce Agencies in Florida (2024)

Best Ecommerce Agencies in Florida

Featured providers

  • Dot Com Development

    Dot Com Developmentcertified-flagverified-flagfeatured-flag

    5
    (8 reviews)

    On Time ... On Budget ... Solutions Exceeding Expectation

    Recommended
    Award-winner
    Dot Com Development is a and awarded and top software development & IT consulting company offering innovative solutions for diverse industry verticals. We strive to be an invaluable catalyst for building a culture of innovation. Our breakthrough web and mobile solutions have the capability to challenge the limits and give business a competitive edge. Our services include Strategic Planning and Consulting UX/UI Design Prototyping and POC's Web Application Development Mobile Application Development eCommerce / mCommerce Development Cloud Development CRM / ERP Development AI/ML Development DevOps Services
    3 works in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce

Best Ecommerce Agencies in Florida

Sort by
  • Gig Miami

    Gig Miamiverified-flagfeatured-flag

    (0 review)
    Award-winner
      We are experts in the branding and e-commerce field, with a holistic focus on fashion, lifestyle, and wellness specialized brands. Our ambition is to cultivate a highly successful and integral brand experience to meet all of your business needs. At Gig Miami, we believe your business goals should be in alignment with well-crafted and effective digital communication. It is our promise to you that all of the services you require to promote your brand will be provided with expertise, love, and dedication that stands the test of time.   64% of consumers say that shared values are the main reason that they have a trusted relationship with a brand. Do you know if your website and marketing materials are truly aligned with your brand’s values? Running marketing campaigns or employing new strategies without getting your branding right first is like shouting at a brick wall. Why? Because your ideal customers aren’t going to listen if your brand doesn’t resonate with them. Branding is everything in business - especially in fashion. When done right, it allows you to connect with your ideal customers who identify with your brand values and aesthetic.   My expertise is to help brands create a beautiful visual identity with compelling messaging that communicates their brand’s values and connects them with their ideal customers, all without the big price tag that often comes along with it. If you’re open to learning more, let’s talk. Book a call with me and receive a free brand audit: https://calendly.com/gigmiami   Services,    Web design. Design and develop a website using Modern fonts. Up to 6 designed Squarespace pages Custom CSS added Responsive design Basic SEO added to website Graphics   Responsive E-commerce Design Design and develop a Flagship E-commerce Customized design for a unique brand experience Custom CSS Responsive design SEO added to website Curated Images & Graphics We have a strong experience with Shopify, Magento...   Full Branding Experience Brand Strategy Logo design Copywriting - Mission, Vision, Values Social media graphics, newsletter design, business cards Brand guideline PDF
    2 works in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Dean Infotech Pvt Ltd

    Dean Infotech Pvt Ltdverified-flag

    5
    (2 reviews)

    Salesforce, Hubspot, Web and Mobile App Development Services

    Recommended
    Award-winner
    Dean Infotech is a Certified Salesforce Partner Company . Offering Salesforce Consultation, Development and Implementation Services. With 12+ years of experience in the industry, we have worked on 200+ Projects along with some of the Foutune 500 companies around the globe inclding USA, UK , Australia and Europe with an experience in diverse industry. We provide end-to-end Salesforce and Hubsopt CRM Development, Software Development, Website Designing & Development, and Mobile Apps Development. Our team of 150+ experienced developers, designers, and consultants possesses a deep understanding of the latest technologies and industry best practices. Why Choose Us? - 300+ Clients Served Globally - 200+ Successful Projects - 100+ Technology Specialist - Flexible Hiring Plans - Boutique Quality - 99.99% Up time Guarantee Our Services: - Software Development Services - Salesforce Development Services - Hubspot Development Services - CRM Solutions - Advanced Web Design and Development Services - Custom Enterprise Software Development Services - Mobile App Development (Android and iOS) Services - Technical Staff Augmentation We're not just transforming businesses; we're shaping the future, one byte at a time!
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Intelifaz

    Intelifazverified-flag

    5
    (1 review)

    Have a cup of ☕ while we code 💻 for you 😉

    Award-winner
    Put the A-Team 💪 on your Software Project 💻 Intelifaz is a tight-knit team of highly experienced creatives, technologists, and engineers creating disruptive Digital Customer Experiences web, mobile, and cloud applications. We create immersive dynamic web applications with the technologies that are driving today’s digital experience. Our applications are scalable, easy to maintain, cross-platform enabled, and ready for the API economy. We provide fully-fledged support throughout the whole project’s lifecycle that covers project management, quality assurance, and product design services. Our tech stack is focused on JavaScript (Angular, React, Node.js), and cross-platform frameworks (React Native, Flutter). The team, the code, the schedule, the budget, everything is customizable. We can handle the full project from start to finish or we can augment your internal resources. EXPERTS IN: 🔥Native Languages: Swift, Java 🔥Java Script Frameworks: Angular JS, React Native, React 🔥Code Frameworks: Intelifaz enterprise frameworks 🔥Mean Stack: Express, MongoDB, Node 🔥QA Automation: Python, Selenium Webpack, Protractor,, cucumber, enzyme, unite testing, regression testing, integration testing, data driven testing, smoke testing. FAVOURITE FRAMEWORKS & TOOLS 1️⃣Communication: Slack, Google Meet, Zoom 2️⃣ Project Management: Jira, Trello, GitHub 3️⃣UX Design: Figma, Sketch, Adobe, Miro 4️⃣Cloud Tools: Google, Docker, Amazon, PubNub, Kubernetes, Splunk 5️⃣CD/CI: Ansible, Jenkins. BACKEND INTEGRATION ✔️ Integration Architecture: Point-to-point, vertical, star, service bus ✔️Scope: Consuming customer/partner services. Building customer/partner integration endpoints. Creating middleware for customer solutions ✔️Technologies IBM websphere, firebase, aws lambda, node js, aws iot, java, google cloud platform, Microsoft azure, adobe experience cloud ✔️3rd party tools: microsoft dynamics, OneLogin, Intercom, Zapier Active campaign, Userback, Smartlook, Sprout, Google, Dropbox, Twilio, SSO?SAML, o Auth, Inteliuser Why Choose Us🙌🏻: ➡️Expertise: Our team of seasoned developers, designers, and project managers possess a wealth of knowledge in the software development industry. We stay up-to-date with the latest technologies and best practices to deliver cutting-edge solutions. ➡️Tailored Approach: We understand that every business is unique, and thus, we tailor our solutions to align with your specific goals and requirements. Your success is our primary focus. ➡️Quality and Reliability: At Intelifaz, we prioritize quality and reliability in everything we do. Our rigorous testing processes ensure that our deliverables meet the highest standards of performance and security. ➡️Customer-Centric Philosophy: Your satisfaction is at the heart of our operation. We value open communication, collaboration, and transparency throughout the development journey, ensuring that you’re involved every step of the way. 🛎️ Our team has successfully developed large scale transformative projects for Office Depot, PWC, City Furniture and Tyco and startups like matrproject.com, Stand4, QuantumLeaf and Pienso. We Accelerate Development, Mitigate Risks & Control Costs. Let us be your trusted partner in innovation and growth. Contact us to embark on an exciting journey of transforming your ideas into reality. Have a cup of ☕ while we code 💻for you 😉
    1 work in E-commerce
    Active in Florida, United States
    From €5000 for E-commerce
  • Merton Way

    Merton Waycertified-flagverified-flag

    (0 review)

    Building B2B Brands to Outperform.

    Merton Way is a hybrid digital marketing agency and business consultancy. We serve early stage companies and divisions of large corporations to launch new brands, products, and services. Some come to us to help turn around a brand or business with P&L challenges. We are full service, providing branding and strategy, research, SEM, SEO, web and ecommerce development, and copywriting for complex or highly technical solutions. More than that, we are business people with management experience at companies like IBM, Apple, and Toyota. We get it.
    2 works in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • We are a Growth Hacking Marketing agency and proud Google Partners. We are passionately obsessed with our clients' ROI and we hack growth by combining creative Pay-Per-Click (PPC) campaigns, Conversion Rate Optimization (CRO), Analytics, and Automation. We are proud to have been featured in Forbes.com and Telemundo.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • CODE CASTLE

    CODE CASTLEverified-flag

    (0 review)
    Somos una agencia con alto standar de calidad: un Scrum master como project manager, una ingeniero ´Cum laude´ como gerente del equipo de desarrollo y un versátil CEO que maneja cualquier solicitud de lenguaje para sus proyectos, Entre nuestros valores esta la mejora continua lo que nos ubica en un nivel de atención que supera expectativas. Siempre tenemos un valor agregado que ofrecer y nos caracteriza la puntualidad y el analisis a medida de los indicadores de resultados que espera el cliente a invertir en un sistema o en una App. ¡CODE CASTLE, superando expectativas!     We are an agency with a high standard of quality: a Scrum master as a project manager, an engineer 'Cum laude' as manager of the development team and a versatile CEO who handles any request for language for their projects. Among our values ​​is continuous improvement. that places us at a level of attention that exceeds expectations. We always have an added value to offer and we are characterized by punctuality and the analysis tailored to the results indicators that the client expects to invest in a system or an App.   CODE CASTLE, exceeding expectations!
    1 work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Webiance

    Webiancecertified-flagverified-flag

    (0 review)
    Award-winner
    Webiance is a Best Digital Marketing And Web Design Agency Worldwide   Webiance is a Best Digital Marketing and Web Design Agency Worldwide offers Digital Marketing Services, Social Media Services, E-commerce Solutions and Website Designing Services   At Webiance, Our primary objective is to help you build and improve your business. As long-established leaders in the online marketing industry, we have the experience and insight to determine the needs of your company and customers, plan and execute processes to align those needs, and ultimately help you attract, engage and convert more customers. Webiance is a Digital marketing and Web Design Agency based out of United States, Canada, United Kingdom and India. We offer Digital Marketing Services, Website Design, E Commerce Solutions, Search Engine Optimization, Pay Per Click, Social Media Marketing and overall Digital Marketing Services. We are catering to our clients based out of USA, Canada, UK, Singapore, Dubai, New Zealand, Australia and other parts of the World.
    1 work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Edbrig

    Edbrigcertified-flagverified-flag

    5
    (1 review)
    Recommended
    We are an independent branding and advertising agency , who helps brands to stand out with the help of our branding and advertising services. Edbrig is one of the fastest-growing branding agencies in Asia and the United States . In a world of chaos, we bring simplicity and creativity together by our intuitive and data-driven approach, our goal to make real brands! We are Strategic Branding and Advertising Agency. We help brands to grow and spread their wings. We love to brand your startup, luxury brand, real estate brand, or law firm .
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • wdmarketingdigital

    wdmarketingdigitalverified-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    No work in E-commerce
    Active in Florida, United States
    From €400 for E-commerce
  • Award-winner
    SpryBit is an IT consultation and solution provider which is home to some of the best skilled technical professionals in the industry. We offer services like Custom Website Design & Development, UI UX Design, Mobile Application Development (Android, iOS, Hybrid), E-commerce Development, CMS-based website Development, IoT, Frontend Technology, Microsoft Technology Development Services, MYOB Integration, Automation Testing Services, Hire dedicated developers Services and more. At SpryBit, our team of professionals put their hardships to develop a unique eye-catchy web design, we introduce mobile applications suitably customized as per client’s requirements as well as we pinch out eminent e-commerce tools for client’s business dealing transactions, totally risk-free.
    1 work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Sigma Solve Inc

    Sigma Solve Inccertified-flagverified-flag

    (0 review)

    Sigma Solve is a firm specializing in technology consulting and software development

    Sigma Solve is a US based software development company providing businesses worldwide with custom software solutions in technologies such as eCommerce - nopCommerce, Liferay, Magento, Shopify, Custom Software development with .NET, Java, Ruby on Rails, Python, Php CRM solutions for Salesforce & Mobile Application development.
    1 work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • DiBrand

    DiBrandcertified-flagverified-flag

    5
    (1 review)

    Development & Design

    Recommended
    At DiBrand we help companies to contact their customers through digital solutions, design and development. We are passionate about creating experiences, exploring new technologies and making compelling designs.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • oMesh Werbeagentur

    oMesh Werbeagenturcertified-flagverified-flag

    (0 review)

    Umsatzstarke Webpräsenz

    Willkommen bei unserer erfolgreichen Werbeagentur! Wir sind spezialisiert auf die Erstellung von maßgeschneiderten Websites und umsatzorientierten Onlineshops für Geschäftskunden. Unser Ziel ist es, Ihren Online-Auftritt zu optimieren und Ihnen dabei zu helfen, Ihre Zielgruppe effektiv zu erreichen. Wir wissen, dass eine gute Website oder ein Onlineshop heutzutage unerlässlich ist, um erfolgreich zu sein. Deshalb arbeiten wir eng mit Ihnen zusammen, um eine maßgeschneiderte Lösung zu finden, die Ihren Bedürfnissen und Ihrem Budget entspricht. Dabei legen wir Wert auf eine benutzerfreundliche Navigation, ein ansprechendes Design und eine hohe Funktionalität. Darüber hinaus bieten wir Ihnen auch professionelles Social-Media-Management an. Wir helfen Ihnen dabei, Ihre Social-Media-Kanäle effektiv zu managen und Ihre Reichweite zu maximieren. Dabei setzen wir auf eine individuelle Strategie, die genau auf Ihre Bedürfnisse und Ziele zugeschnitten ist. Vertrauen Sie auf unsere langjährige Erfahrung und unser Know-how, um Ihr Unternehmen erfolgreich online zu präsentieren. Kontaktieren Sie uns noch heute, um mehr darüber zu erfahren, wie wir Ihnen helfen können. https://youtu.be/PpgS8KYKbMU
    1 work in E-commerce
    Active in Florida, United States
    From €65 for E-commerce
  • LeverX

    LeverXverified-flag

    (0 review)

    Innovate Today To Lead Tomorrow.

    Award-winner
    LeverX is an international company and a global system integrator that specializes in SAP implementation and customization. For over 20 years, it has been sustaining a reliable and reputable partnership with SAP. LeverX has deep expertise is based on successful cooperation with SAP as a Preferred Vendor since 2004. As an SAP Gold Partner and Global Strategic Supplier, the company helps companies leverage investments in SAP solutions. LeverX has delivered over 950 successful projects for 800+ customers. The key industries include manufacturing, automotive, telecommunications, healthcare, transportation, retail, financial services, etc.
    1 work in E-commerce
    Active in Florida, United States
    No budget for E-commerce
  • Hairpin

    Hairpincertified-flagverified-flag

    (0 review)

    UX Subscriptions for Startups

    Welcome to Hairpin – Your Dedicated UX Subscription Design Agency! At Hairpin, we redefine the way startups approach UX design. We understand the challenges you face – from tight budgets to the scarcity of top-tier designers. That's why we've created a flexible subscription model, giving you access to dynamic UX solutions without breaking the bank.
    1 work in E-commerce
    Active in Florida, United States
    From €3000 for E-commerce
  • Vape Star USA

    Vape Star USAcertified-flagverified-flag

    (0 review)

    Vape Star USA Shop Pod System - Vape Star USA

    Get ready to elevate your vaping experience with our Premium Pod System which is available in existing Products. So Order Now.
    1 work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • eCommerce Cosmos exists to help eTailers mitigate shopping cart abandonment, and increase lifetime customer value with email automation.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • On Tap Growth

    On Tap Growthcertified-flagverified-flag

    (0 review)
    We are global Creative Marketing and Advertising agency with the mission to help brands, enterprises and startup companies to connect, engage and retain their potential customers. Unlocking business growth for every entrepreneur. Creative business growth solutions we offers: Design Branding - Creatives Design/Logo Design,  Brochure designs | Digital marketing Banner ads & rich media ads,  Brand Marketing & Communication Solutions Brand Activation & Brand Experience,  Media Planning & BuyingVideo Production and Promotion, Mobile Marketing Strategy | Mobile Advertising Mobile AppsPay Per Click Advertising Online and Offline PR | Contextual Advertising | Social CRM Social Apps and Fan  Social Media Campaigns & Marketing Messaging  | multiple touch points based communications | Integrated marketing Campaigns |Online Presence Enhancement
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Sapdra

    Sapdracertified-flagverified-flag

    (0 review)
    SAPDRA is an IT Company located in USA & India, helping businesses by delivering IT services including website design, website development, app development, software development, CRM, e-Commerce development and digital marketing services. Why Sapdra? ISO Certified Company Worldwide Services Quality Services 24X7 Environment Data Security Data Integrity & Reliability Money Return Policy Lifetime Support Trust Worthy Company   Our Vision The highly professional and certified experts at SAPDRA, have this unique vision of placing their clients in the league of digitally developed establishments. We aim at fostering growth in the best possible way in your budget.   Our Services Website Designing Website Development Software Development App Development IT Outsourcing CMS Development Employee Outsourcing Content Writing & PR Digital Marketing
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Perconvly Media

    Perconvly Mediacertified-flagverified-flag

    (0 review)
    Ecommerce Scaling Company for Proven Stores doing more than $15,000/month in Revenue. We focus on delivering High ROAS. Paid Media and Acquisition Experts, Digital Media Buyers testing and scaling products through Facebook Advertising, Native Advertising, Google Adwords and more. Conversion Rate Optimization Experts delivering  We scaled a brand from $32,000/month to $530,000/month in under 2 years From $110,000/month to $185,000/month From $2MM per year to $4.3MM in under one year
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Octal IT Solution

    Octal IT Solutioncertified-flagverified-flag

    (0 review)

    Offshore IT Solutions

    Octal IT Solution is an ISO 9001:2015 Certified Company with its physical presence in the USA, UK, India, Singapore & Dubai, and serving its clients across the globe. Established in the year 2004, Octal IT Solution has developed more than 1,100 Mobile and Web Apps for over 700 clients from all parts of the world. With a team of 150+ seasoned professionals, we offer innovative solutions from our well-established development centers as well as through onsite work environments. With top-notch & affordable solutions, Octal IT Solution has earned notable associations from technology leaders like Microsoft, NASSCOM, Amazon Web Services, Acquia, STPI, D&B and many more. We are appreciated by hundreds of clients on AppFutura, Clutch, GoodFirms, AppLancer, Appdexa, and Extract, consistently being among the Top-10 Mobile App Developers on these platforms. GoodFirms Listed Octal IT Solution as the best web design solutions, giving organizations in a survey of global web design companies, was conducted among 200+ web design agencies adjoining with freelance web designers. Octal IT Solutions specializes in fantasy Sports and E-Wallet App Development, delivering cutting-edge technology solutions for modern digital transactions and gaming experiences.  
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • When you have a great business, you would want a great marketing agency to match with it.   That is why Reacher Digital Solutions was formed. Rooted with the capability to see the bigger picture. We help everyday businesses big or small take the big leap to take-off and achieve their goals. With the new era of marketing here, we can utilize multiple digital marketing strategies to pinpoint exactly what to use and what will be most beneficial for your business.   We research, strategize, take action, and prove with the results.   No B.S - Straight to the point.     Its time to take part in this partnership and expand your horizons for you and your business.   The perfect terminal for your marketing, domestic or international.   We provide multiple services that can be a la carte or packaged: -Social Media Marketing -Web Design & Hosting -Press releases -Pay Per Click -Search Engine Optimization -Photography   -App Development   Just to name a few     There is no secret sauce to marketing. Only consistent implementation of marketing tactics with the results.   Knowledge is power - power is knowledge   We have done the research and studying and have been certified to prove our understandings.   True Partners - Not just another agency. You won’t be pushed aside. We know success can only be achieved if there is one-on-one communication.  
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • 6C Marketing

    6C Marketingcertified-flagverified-flag

    (0 review)
    We help our clients solve issues and concerns regarding their digital footprint. From brand positioning to lead generation, regardless of size of the company, the ideal customer is an organization that engages with us to solve big problems. Industries of Expertise We have provided our services to many clients from differents industries, however we believe we are best in the following areas: HealthCare Manufacturing B2B Ecommerce Services SaaS Our typical clients (e.g. startups, l arge businesses) Most of our clients are mid-sized Businesses in the US who want to optimize their current campaigns or are about to start a digital transformation. We also have a whitelabel service for Agencies. Skills & Experience We combine a set of different tools and skills, these include: Unbounce HubSpot Google Ads, Bing Ads, DoubleClick, Google WebDesigner Facebook Ads, LinkedIn Ads Google Analytics, Google Tag Manager WordPress, WooCommerce & Magento 2 Adobe Illustrator, Photoshop, InDesign Adobe After Effects InVision About Us We are a Detailed Oriented Marketing Agency based in Miami and Buenos Aires. We are Google Partner! Our Typical Process We prefer to offer a 30 min free consultation like an on-board call to get to know your business. Contact Us Our staff speak English, Spanish and French fluently and we reply almost instantly during our working hours.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Attrock

    Attrockcertified-flagverified-flag

    (0 review)
    Partner with Attrock - the results-driven digital marketing company that big brands like HubSpot, BigCommerce, GetResponse, IMH, ShaneBarker.com, and Semrush trust.   We’ve successfully helped our clients : 🔎Rank for 5,000+ keywords on page 1 of Google 💸Generate $4 for every $1 spent on our marketing strategies 🎯Drive 128% more leads and conversions 🚀Increase monthly website traffic to 300K+ Generate $160K earned media value 📈Scale an agency from 5-figure to 7-figure income in just two years   Our digital marketing services include but are not limited to : SEO | Content Marketing | Influencer Marketing | Online PR | Lead Generation | Landing Page Optimization | Affiliate Marketing | Email Marketing | Podcast Launch   Join forces with our marketing gurus to drive more revenue!
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • IPS USA

    IPS USAcertified-flagverified-flag

    (0 review)
    Before selecting a BPO services provider, keep in mind the following points to come to a better decision. Moreover, working with IPS USA, you stand to achieve these benefits comprehensively. 1. Better Focus on What You Can Do Better Many tasks do not have a direct impact on your profitability; however, most of these low profitability tasks are crucial to the performance of core operations. Some of these tasks may require specialized knowledge and experience, like legal services or medical billing services; others may be rudimentary and anyone can perform it with just a little education or training, like data entry. Still, other tasks may only need to activate once a year, like the annual audits of various departments. Outsourcing your functions like customer service calls, digital marketing, mobile app development, sales, and social media marketing is not only an affordable method but often turns out to be revenue generating. 2. Economies of Scale Due to Lean Operations Speaking of efficiency, when you take the help of a BPO services provider to perform one of your functions, it can give tremendous results due to economies of scale. As an excellent business process outsourcing firm, IPS USA has specialized staff dedicated to specific functions and there are separate teams working on different projects. Additionally, we also have specialized equipment and software technology to aid in the tasks which can be expensive for an individual organization. Consequently, few of our regular clients ask us to perform a range of services on their behalf consistently. Years of performing related tasks, repeatedly, has given us the experience and efficiency to shine for them. 3. Increased Return on Investment (ROI) Handing over the non-core activities to us will not just improve your productivity in the core competency areas, but reduce the overall expenses as well. It will generate high sales and quick conversions for you since we carry expertise in customer relationship management, software development, digital marketing, medical billing, claims submission and health IT management in general. Therefore, you benefit from multiple angles and use every aspect of our business to grow your business exponentially. 4. Safe and Secure Data When we enter into a contract with a client for performing tasks on their behalf, we exchange essential business information or user data. We use such information only for legitimate purposes according to contractual and legal limitations. As a company policy, we adhere to all the US and International legal requirements as applicable in maintaining a users’ data confidentiality. Furthermore, we have invested in state-of-the-art technologies and equipment to make sure that appropriate organizational, technological, and procedural safety measures are set in place as mandated by the relevant US and International laws. BPO services in line with the law of the land are what every client wants as a priority. 5. Reduced Legal Burden While subcontracting business operations to business process outsourcing companies does not absolve firms of all legal burdens and responsibilities, it certainly reduces the liability. IPS USA, as a BPO firm, understands the legal obligations in letter and spirit. We make sure that the contracts elaborate our responsibility down to the minute details. After the contract finalizes, we stick to every word of the agreement to the best of our abilities. The List of Services IPS USA delivers excellent BPO services to a wide range of industries. The BPO solution definitely holds on and sticks until the end. Some of the services we offer include – • Customer Relationship Management • Outsourcing Sales Services • Full-Scale Digital Marketing Services • Search Engine Optimization • PPC Management Services • Social Media Marketing • Web and Mobile Application Development • Custom Software Development • HR Portal Development and Management • Telemarketing • Medical Coding and Billing Services • Medical Billing Software – RCM Solutions • Cloud Services       Share Your Project Details and Get a Free Estimate You can reach us at info@ipsusa.net or through this number  1-909-245-6251 . The social media pages of Facebook, Twitter, and LinkedIn always respond to your queries. Do follow us on LinkedIn – https://www.linkedin.com/company/information-process-solution/ and get a grip on your business activity.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Juno Digital Development is a leading provider of web development and digital marketing services to a wide variety of companies from Fortune 500 companies to start-ups. We are experts in bringing the highest ROI traffic to our clients' websites. We are experts in SEO. We can manage your PPC/Ad Buy marketing to increase from 200-800% the ROAS of your marketing budget. We are also expert developers and have expertise in HTML, CSS, JavaScript, PHP, Java, Ruby on Rails, Magento, WordPress, and Drupal.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • MObeats

    MObeatscertified-flagverified-flag

    (0 review)
    We love solving problems while creating cutting-edge products and innovative experiences We love helping companies achieve their business goals and make great relationships with their users through purpose-data driven methodologies with custom technologies.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Much More Clients  is a  full-service digital marketing agency . We’ve successfully provided a full-stack of marketing services to businesses in all industries. Our digital marketing services include Ocala Web Design, Ocala Digital Marketing, Ocala Social Media Management, Ocala SEO (Search Engine Optimization), Ocala Video Production, and Ocala Digital Marketing Consulting. We work with eCommerce companies,  B2B , and  B2C  Companies. Don’t team up with just any digital marketing agency, partner with an agency  you can trust . If you’ve ever found yourself searching “Ocala Digital Marketing”, “Ocala Marketing”, or even “Ocala Web Design”, then you’ve come to the right place! With clients in Orlando, Miami, Jacksonville, Tampa, and Ocala, we have experience in all the major markets of Florida. Our experience and results give us the opportunity to bring results that can perform well essentially anywhere. It also helps us see where things are falling short (and how to fix those issues), so, if  you want your business to make more money  then Grab a Free Consultation! At  Much More Clients , an Ocala Marketing Company, our expert marketers will talk to you one-on-one to discuss where your business lies at now and how we can help take you to the next level. Our digital marketing experts will ensure that your website, social media, SEO, and advertisements are handled and all your needs are met. Our dedicated Ocala Marketing and Ocala Web Design team will act quickly to identify all potential problems to get you the best results possible. All the while, you can feel comfortable knowing  your business’s marketing is completely taken care of, from start to finish.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • First established in 1997, Ventura Web Design & Marketing is a full service digital agency specializing in website design and development, as well as e-commerce support. We can do anything from building new online stores and websites, redesigning or optimizing current websites or help with growing your business/ finding you new customers. We work with platforms such as Shopify, Miva, Bigcommerce, Woo commerce, 3dcart and WordPress. We are proud to offer and have extensive experience in a wide range of services. We have a strong and diverse portfolio having serviced several different types of websites including: Doctors, Lawyers, Retail Stores, Wholesalers / Manufacturers and apartment home websites. Our goal is to see all of our clients succeed and we work diligently to ensure that!
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Seller’s Bay, LLC has locations in Orlando and Lake Mary, Florida USA but we accept projects worldwide. We are a Google AdWords certified partner and have been building and marketing websites since 1998. Seller’s Bay provides a range of web design and online marketing services to ensure your business gets more sales, customers, leads and brand recognition.   We have a highly skilled team of web designers, online marketing experts and web developers to ensure your project is completed as efficiently as possible and to the highest standards.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  •  
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  •  
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  •  
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Since its existence in 2012, APPWRK IT Solutions is continuously developing web and mobile applications and user-friendly websites for the business all across the globe. We have fruitfully delivered numerous projects in the IT field irrespective of Mobile, Desktop and Web applications. We work with both startups and large companies from the US to the UK, Canada to UAE. Our strategic approach to web design focuses on technology companies (B2B, SaaS, and B2C), e-commerce, and other companies. Our web designers are dedicated to making new milestones in the web designing industry. We are the pioneers of web design who build industry-specific custom websites. Our highly experienced and custom team helps your businesses to scale up development, design, and digital marketing proficiency. The reason is the unique development process that makes us different from others. We follow a unique development process. We do: Goal identification Scope identification Design and development Integration and Testing Deployment Maintenance We have done more than 530 projects in: IT Crypto Healthcare Digital Marketing EdTech Saas Products Quality Assurance Mobile app development UI/UX development Our services include strategic consulting, web designing, mobile and web app development, digital marketing and branding. Moreover, we also specialize in numerous CMS (content management systems) such as: WordPress Magento Craft Drupal Apart from it, we work with the advanced and most widely used technologies such as: HTML CSS React Node.js PHP Flutter ..
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • At helium creative, We provide branding + design studio creating dynamic, personified brands for clients who value an in-depth, collaborative approach when it comes to developing their identity, web design & development, marketing strategy + collateral, and digital + print materials. Since our incarnation 18 years ago, helium creative has been dedicated to delivering a higher creative standard through superior service and attention to detail. This approach has led to successful, award-winning designs and long-standing relationships. Unwavering devotion to an immersive process of listening, discovery, creation, engagement, and storytelling enables helium to identify the fundamental idea for why a brand exists and communicate its distinctive experience through great design. helium creative has launched helium reality, a new division specializing in augmented reality and 3D rendering services. With this new division, we can now make what was once a dream, into a reality. About Owner = Christopher is involved with every project his company takes on. He has instilled the hands-on, caring approach that is helium creative and provides the leadership that separates our business strategy and client relationships from other agencies. He leads with his head but follows his heart. Christopher is the captain of our ship, ensuring that helium stays on the rise.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • WeDoWebApps LLC

    WeDoWebApps LLCcertified-flagverified-flag

    (0 review)

    ECommerce Website Development, Mobile App Development

    WeDoWebApps LLC is a leading IT company engaged in providing prominent solutions for ECommerce Website Development, Mobile App Development, UI/UX and Digital Marketing to its globally spread clients.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Sunraise Solutions US LLC

    Sunraise Solutions US LLCcertified-flagverified-flag

    (0 review)

    360° DIGITAL MARKETING GAME-CHANGER

    No work in E-commerce
    Active in Florida, United States
    From €600 for E-commerce
  • Vero Web Consulting LLC

    Vero Web Consulting LLCcertified-flagverified-flag

    (0 review)

    Web Technology Experts

    With melting pot of skills, passions, disciplines and more... Having 20 years experience website and web application, Vero Web Consulting LLC is where you can find the best web technology experts.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Johari Digital Healthcare Limited

    Johari Digital Healthcare Limitedcertified-flagverified-flag

    (0 review)

    Engineering you can trust

    Johari Digital is a global MedTech company that provides innovative, reliable, high quality Medical Device Manufacturing to clients across various industries. Our Full Turn Key services range from design to development, electronics and mechanical engineering, PCB manufacturing, prototyping, system integration, packaging and supply chain compliant with MDSAP, ISO 13485:2016 and FDA (21 CFR 820) standards and processes. We also offer end-to-end guidance to help clients take their product to market through regulatory and compliance assistance at every stage of client project. From our humble beginning in a small garage in the city of Jodhpur in India Johari Digital now provides OEM and Contract Manufacturing services world-wide from a modern 65,000 square foot facility. Our customers include many of the global industry giants such as Stryker, Jabil, Gettinge, Nemaura and Cutera. Numerous small companies and start-ups have also taken advantage of our medical device design, engineering and manufacturing capabilities. Our manufacturing services help reduce client costs and reduce time-to-market for their products.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • IKONIC: Software & Web Development Company

    IKONIC: Software & Web Development Companycertified-flagverified-flag

    (0 review)

    Custom Software, Web and ERP Development Solutions

    Award-winner
    IKONIC - Represents Software & Web Development Agency We provide services in software development, web development, e-commerce solutions and mobile application development. We strive to be your IT partner and help you grow your business with our cutting-edge technologies and expertise. Industry Leading Tech Specialists Highly Selective Agile Team In Top 10 USA Software Development Companies Providing Services To USA Clients From Past 7 Years.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Phone Number: +1 321-261-0881 Rank higher on Google searches for your services! Cerebral Analytics® Digital Marketing is "Data-Driven". We specialize in small business Local SEO, WordPress(Website) Design, and Google Analytics. Ready to compete for more online traffic? Get your free SEO audit today!
    No work in E-commerce
    Active in Florida, United States
    No budget for E-commerce
  • Medical Pharmacy USA

    Medical Pharmacy USAcertified-flagverified-flag

    (0 review)

    Online Pharmacy Store

    About Us – The main concentration of our company is to work according to the global standard of the business. We are working in this field for more than 10 years with thousands of satisfied customers so you can rely on our products. With over 10 years -of experience in online pharmacy, we provide our customers with genuine products at affordable prices. Our company shall be the leading company in the online distribution of pharmacy in partnership with many national and international companies. Our company strictly follows the guidelines of the U.S. Food and Drug Administration. For your satisfaction, you can check the Verified Internet Pharmacy Practice Sites (VIPPS) Seal. It means that our company serves a safe Internet Pharmacy and met all the legal requirements. What Do We Offer We didn’t accept any order without the proper doctor’s prescription. Our company is a single window for everyone because we offer branded and Genuine Medicines in the field of neurology, cardiology, psychiatry, allergy, immunology, anesthesiology, diagnostic radiology, medical genetics, gynecology, pathology, pediatrics, urology. Other Services We Offer To accomplish our goal to become one of the leading companies with millions of customers we offer several services -:
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Aspired.io

    Aspired.iocertified-flagverified-flag

    (0 review)

    Build Your Dedicated Remote Development Team Elite Remote Team, On-Demand Like many leading busi

    Aspired helps its clients hire and build a remote autonomous dedicated team by carefully selecting the elite from the global pool of talent. Our team of experts identify new & emerging tech hubs and pair our top engineers with teams engaged in solving thought-provoking problems. We provide complete operations and services to give companies all the benefits of a new office without any hassle. By adequately understanding our clients’ project requirements, we identify the roles required and then shortlist the candidates most suited. All our resources are subjected to a stringent screening process to ensure our highest resource quality standards are met and the resource fits the role from a technical & industry-relevance perspective.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Keyideas Infotech Private Limited

    Keyideas Infotech Private Limitedcertified-flagverified-flag

    (0 review)

    Top Web Design and Software Development Company

    Award-winner
    In 2007, our journey began as a modest software development agency. Since then, we've continuously progressed, evolving into a comprehensive provider of top-tier website design and development services. Our expertise spans design, mobile apps, e-commerce websites, UI/UX, and marketing. At Keyideas, we take immense pride in our capability to deliver tailored web excellence that caters to the distinct requirements of top industries. Our comprehensive suite of web and mobile app development services seamlessly integrates innovation and expertise, offering bespoke solutions that empower businesses across a wide range of sectors.
    No work in E-commerce
    Active in Florida, United States
    From €3000 for E-commerce
  • XeoDev

    XeoDevcertified-flagverified-flag

    (0 review)

    Innovative ideas that have yet to be discovered!

    XeoDev partners with forward-thinking companies on disruptive projects and innovative business models. Our ideal client is a solopreneur or business that needs a strong technology partner to expand their industry influence. Clarity is our core strength as a software development agency - world-class technical specifications lead to world-class web and mobile application assets that are easy to use. Architected from the beginning to be in the cloud, highly available and scalable by our certified Solution Architects.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Star Knowledge

    Star Knowledgecertified-flagverified-flag

    (0 review)

    Star Knowledge: Global elite in Software, Engineering, Business Consulting for SMBs, public agencies

    Star Knowledge crafts exceptional digital experiences, delivering transformative IT consulting for enterprises and SMBs. Specializing in Software Development, Microsoft Platform, SharePoint, Java, Open Source, Mobile Apps, Cloud Solutions, Web, .Net Applications, Identity & Access Management, Office 365, Azure, Hybrid Apps, PHP, and Power Apps. Your trusted partner for innovation and tailored solutions.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • DPL

    DPLverified-flag

    (0 review)

    Innovation as a Service

    DPL is one of the leading software development and IT companies around the world. Established in 2003, DPL serves customers in all major regions emphasizing most on Europe, Middle East and Americas. The company is based in Islamabad, Pakistan with its regional offices located in USA and Sweden. DPL is the pioneer in Agile practices and innovation culture in Pakistan. The company has been recognized globally in various magazines and rankings for its unparalleled workplace environment. The flat culture and holacratic approach encourage employees to work devotedly and stimulate innovations in the process. Clients from a wide range of industries including, but not limited to Healthcare, Fintech, Automotive, Mobility, Telco, Education, Media and E-commerce make a highly diverse portfolio at DPL. The services primarily include Digital Transformation, Product Engineering, IT Strategy & Consulting, and Custom Software Development. DPL leadership plays a crucial part in restructuring of the IT sectors in various regions of the world. The members of the executive team serve at the core of policy making and implementation of #DigitalPakistan campaign. DPL also hosts annual Agile Conference and serves to disseminate the knowledge and best practices in Agile transformation. Let's talk to identify the areas of mutual growth and collaboration.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • Condor Agency

    Condor Agencycertified-flagverified-flag

    (0 review)
    No work in E-commerce
    Active in Florida, United States
    From €3000 for E-commerce
  • Universell LLC

    Universell LLCcertified-flagverified-flag

    (0 review)

    Omnichannel Solution to Easily Run your Business

    We are a SaaS ecosystem that helps you get new clients, earn more with existing ones and reduce up to 75% Online Workload. We provide +45 apps free to help you replace CRM, E-commerce store, orders, payments, and more saving up to 72 days a year of workload and boost 2x your revenue.
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce
  • jinne store

    jinne storecertified-flagverified-flag

    (0 review)
    No work in E-commerce
    Active in Florida, United States
    From €1000 for E-commerce

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Encounter new customers rapidly with a lucrative campaign in Florida!

What solutions will an ecommerce marketing agency offer?

A wide list of services is put forward by ecommerce marketing agencies, for instance e-commerce marketing and e-commerce designing. Thus don't hold back anymore and call those firms through our website, and you will be able to begin your project really soon.

Is your firm designing a project in e-commerce platform maintenance, or is your firm seeking a company competent in ecommerce for an activity in e-commerce marketing? Then your company will definitely meet your future partner near Florida on our team. And because we select our companies depending on on well-defined benchmarks, you can rest on the fact that the bureaus you will meet through our website will be capable and able to meet your requirements.

We can aid you nominate the most accomplished company!

We, at Sortlist, believe in crushes between a company and an ecommerce marketing agency. Thus we will, bearing in mind your operation, prepare a directory of all ecommerce marketing agencies that will be apt to deal with all your solicitations.

Sortlist helps you find the best agency in Florida

The algorithm, constructed by Sortlist, supports companies who want to encounter the best communication firm for their project. And considering Sortlist has a network of more than 50.000 bureaus, we can affirm that your ecommerce marketing agency in Florida without doubt is in our inventory.

Florida, a mountain of perks to collaborating with an ecommerce marketing agency.

For small-scale and large enterprises is constructing a brand-new affiliation with a collaborator not at any time painless. Thus it is of foremost importance to dig up the ideal partner, and Sortlist can support your firm with this move! Even the modest firms that do not have the budget will, thanks to us, manage to identify the pertinent firm for their forthcoming collaborations.

Activities in ecommerce are required for your business. And with Sortlist you will have the means to smoke out the finest bureau for your ecommerce campaign in Florida. Please deliver Sortlist your brief, and our team will contact your company as soon as possible.