The 10 Best Ecommerce Agencies in Miami (2024)

Best Ecommerce Agencies in Miami

Featured providers

  • Dot Com Development

    Dot Com Developmentcertified-flagverified-flagfeatured-flag

    5
    (7 reviews)

    On Time ... On Budget ... Solutions Exceeding Expectation

    Recommended
    Award-winner
    Dot Com Development is a and awarded and top software development & IT consulting company offering innovative solutions for diverse industry verticals. We strive to be an invaluable catalyst for building a culture of innovation. Our breakthrough web and mobile solutions have the capability to challenge the limits and give business a competitive edge. Our services include Strategic Planning and Consulting UX/UI Design Prototyping and POC's Web Application Development Mobile Application Development eCommerce / mCommerce Development Cloud Development CRM / ERP Development AI/ML Development DevOps Services
    3 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • SEVEN

    SEVENcertified-flagverified-flagfeatured-flag

    5
    (7 reviews)

    🏆 Exceeding Your Expectations

    Award-winner
    SEVEN is an IT partner with time-tested expertise in solving complex software challenges requiring narrow specialization . One of our biggest strengths is finding unique approaches and solutions for startups and businesses from a wide variety of industries, including crucial ones like healthcare & education. We take pride in our ability to find the technical solution and ensure that it leaves our clients room for growth and protects them from undesirable financial and technological consequences. We apply our extensive expertise to anticipate the needs of our clients and suggest improvements from a new, fresh angle. With SEVEN, our clients team up not just with tech-savvy people but with a group of experts who know how technology influences the business and how to make it align with sustained growth in the future.
    7 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Web Design Glory

    Web Design Glorycertified-flagverified-flagfeatured-flag

    4.9
    (33 reviews)

    "Rising Brands for Digital Glory!"

    Recommended
    Award-winner
    Web Design Glory is a professional web design and development agency that offers a wide range of services to help businesses establish a strong online presence. Our team of experienced designers and developers works closely with clients to understand their unique needs and create customized solutions that meet their specific requirements. Our services include Website Design, Web Development, Mobile Application, Branding Solutions, Digital Marketing, Domain & Hosting, Video Animation & Content Creation. We specialize in creating modern, responsive websites optimized for search engines and providing a great user experience. Our web development services include e-commerce solutions, content management systems, and custom web applications. At Web Design Glory, we are dedicated to providing high-quality services that deliver results. Contact us today to learn more about how we can help your business succeed online.
    5 works in E-commerce
    Active in Miami, United States
    From €186 for E-commerce

Best Ecommerce Agencies in Miami

Sort by
  • Dot Com Development

    Dot Com Developmentcertified-flagverified-flagfeatured-flag

    5
    (7 reviews)

    On Time ... On Budget ... Solutions Exceeding Expectation

    Recommended
    Award-winner
    Dot Com Development is a and awarded and top software development & IT consulting company offering innovative solutions for diverse industry verticals. We strive to be an invaluable catalyst for building a culture of innovation. Our breakthrough web and mobile solutions have the capability to challenge the limits and give business a competitive edge. Our services include Strategic Planning and Consulting UX/UI Design Prototyping and POC's Web Application Development Mobile Application Development eCommerce / mCommerce Development Cloud Development CRM / ERP Development AI/ML Development DevOps Services
    3 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • SEVEN

    SEVENcertified-flagverified-flagfeatured-flag

    5
    (7 reviews)

    🏆 Exceeding Your Expectations

    Award-winner
    SEVEN is an IT partner with time-tested expertise in solving complex software challenges requiring narrow specialization . One of our biggest strengths is finding unique approaches and solutions for startups and businesses from a wide variety of industries, including crucial ones like healthcare & education. We take pride in our ability to find the technical solution and ensure that it leaves our clients room for growth and protects them from undesirable financial and technological consequences. We apply our extensive expertise to anticipate the needs of our clients and suggest improvements from a new, fresh angle. With SEVEN, our clients team up not just with tech-savvy people but with a group of experts who know how technology influences the business and how to make it align with sustained growth in the future.
    7 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Web Design Glory

    Web Design Glorycertified-flagverified-flagfeatured-flag

    4.9
    (33 reviews)

    "Rising Brands for Digital Glory!"

    Recommended
    Award-winner
    Web Design Glory is a professional web design and development agency that offers a wide range of services to help businesses establish a strong online presence. Our team of experienced designers and developers works closely with clients to understand their unique needs and create customized solutions that meet their specific requirements. Our services include Website Design, Web Development, Mobile Application, Branding Solutions, Digital Marketing, Domain & Hosting, Video Animation & Content Creation. We specialize in creating modern, responsive websites optimized for search engines and providing a great user experience. Our web development services include e-commerce solutions, content management systems, and custom web applications. At Web Design Glory, we are dedicated to providing high-quality services that deliver results. Contact us today to learn more about how we can help your business succeed online.
    5 works in E-commerce
    Active in Miami, United States
    From €186 for E-commerce
  • Shiitake Creative

    Shiitake Creativecertified-flagverified-flag

    5
    (3 reviews)

    A Tokyo-based bilingual creative agency 🍄

    Recommended
    Konnichiwa from Tokyo! 😊 We're here to help you successfully navigate the Japanese market. Shiitake Creative is a multicultural and multilingual creative agency specializing in design, copywriting, and localization. Working with us is easy because we speak both languages (literally and culturally) — yours and your Japanese clients'. Contact us if you need help with: Making a website in Japanese Social media assets and ads for your products Digital assets and copywriting for your Amazon Japan product page Translations and transcreation to Japanese Design that will do well in Japan (Logo, Fonts, Websites, Print, etc.) Written material in Japanese (Press releases, Sales decks, etc.) Photo & Video Content Creation in Japan Marketing & Events Business advice on entering the Japanese market Let’s chat further! konnichiwa@shiitakecreative.jp
    2 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • ABC DIGITAL (by ABCW)

    ABC DIGITAL (by ABCW)certified-flagverified-flag

    4.6
    (11 reviews)

    Se parte de la Revolución Digital Global

    Recommended
    Award-winner
    ABC Digital es una de las agencias holding de ABCW, contamos con más de 12 años de experiencia en el mercado y contamos con el mejor talento internacional. Hemos sido reconocidos como "la mejor agencia de publicidad internacional" por Merca 2.0. Contamos con más de 200 colaboradores que se encargan de crear estrategias digitales integrales, innovadoras y a la vanguardia de las tendencias globales de marketing digital. Algunos de nuestros servicios son: SEO, gestión y manejo de redes sociales, campañas publicitarias en medios digitales, estrategias de inbound marketing y desarrollo de sitios web, e-commerce, aplicaciones móviles y landing pages con alta experiencia de usuario e interactividad. Algunos de nuestros clientes son: Playa Resorts, EY, Energizer, Maple Bear, Panasonic, entre otros, con los cuales hemos logrado llevar sus resultados a otro nivel. Actualmente somos Google Premier Partners, Meta Business Partners, Hubspot Partners y contamos con acceso a Amazon Web Services, aportando alto valor en las estrategias de cada uno de sus clientes. 🇺🇸 https://abcdigitalagency.us/ 🇲🇽 https://www.abcdigital.mx/ 🇨🇴 https://abcdigital.com.co/
    No work in E-commerce
    Active in Miami, United States
    From €800 for E-commerce
  • The Goat Institute

    The Goat Institutecertified-flagverified-flag

    (0 review)

    Fueling success through tech, guidance, and innovation!!

    Award-winner
    Welcome to The Goat Institute, Miami’s premier digital marketing agency, dedicated to empowering businesses to achieve their digital aspirations. Our professional team, proficient in diverse areas like Web Design, SEO, PPC, Content Creation, and Social Media marketing, tailors strategies that surpass expectations. We value each client as a partner, investing time to understand unique needs. We transform your vision into a tangible digital reality. With 3+ years of combined experience in the industry, TGI is your dedicated digital marketing agency. We live and breathe Technology, Guidance, and Innovation, empowering businesses like never before. Our personalized service and cutting-edge solutions fuel online growth, creating inspiring success stories for our clients. Join our ongoing story and embrace the future of achievements together!
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Zetenta

    Zetentaverified-flag

    5
    (7 reviews)
    Award-winner
    Somos una agencia de Marketing Digital Full Service con oficinas en Buenos Aires y clientes en todo el mundo. Tenemos 16 años de experiencia trabajando en proyectos web, ecommerce, marketing de contenido y medios online. Trabajamos en equipo con empresas grandes y medianas, incluyendo compañías globales como Disney, ESPN, Lexus, Peugeot, Diageo, Mondelez, Novartis, Mabe y Turner. Nos especializamos en las siguientes industrias: Inmobiliaria, Alimentos y Bebidas, Turismo, Medios de Comunicación, Farmacéutica, Automoción y Electrónica de Consumo.
    4 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Tech4States

    Tech4Statescertified-flagverified-flag

    5
    (10 reviews)

    Top full-stack Web Development & Marketing Agency.

    Recommended
    Tech4States is a full-stack creative agency offering a wide array of services in digital marketing, web design and development, ecommerce development, app design, and creative writing.
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • UO Solutions

    UO Solutionsverified-flag

    5
    (5 reviews)

    Scale Your Business Digitally

    We are a 360° digital agency that drives results. We'll work with you to develop a customized strategy and optimize your digital footprint for maximum impact.
    3 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Absolute Web

    Absolute Webverified-flag

    5
    (2 reviews)
    Award-winner
    Our name really tells you everything you need to know, Absolute Web is a Creative Digital Commerce Agency, established in 1999, providing your business with results in absolutely any aspect of marketing. A highly skilled team comprised of web designers and developers, e-commerce managers, content creators and marketing experts with years of experience in the industry, are ready to grow businesses across many platforms and industries. Led by an entrepreneurial spirit, we treat every client’s business as our own. Taking the time to fully immerse ourselves in their respective industry by identifying competition, trends, failures, and successes is key to working with our clients to developing tailor-made strategies that produce results. Absolute Web is a full-service agency with strong abilities in ecommerce development and management as well as marketing, photography, video and content creation. Based in Miami, we specialize in custom development of Ecommerce Solutions on Magento, Shopify & BigCommerce platforms, informed by strategy and guided by our client’s goals we utilize all of our assets and expertise to ensure results.
    3 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Wegacha

    Wegachacertified-flagverified-flag

    5
    (2 reviews)
    Award-winner
    We get it. You have a great business idea, but you’re sitting at your desk thinking, “How the F do I start?” “Who do I call?” “How do I give this idea life?” We get it. Your imagination is running wild. There’s no stopping your thoughts about your idea and how it could change your world. We get it. We were there ten years ago. Tired of our nine-to-five. In our bellies we felt the fire. And we know that a good business take time to grow, There’s a long way to go, from a person with a good idea, to a successful entrepreneur. But don’t worry. Be happy. We got you. We’ve been through this before. We’ve been around the block. And around the world. We’ve seen the good days and the bad days. And now, we’re standing stronger than ever. So, are you ready? We. Are. Going. To. Build. Great. Things. Together. Step by step. Brick by brick. Pixel by pixel. We’re thinkers, dreamers, doers, storytellers and hackers with a cause. That will guide you through this new journey into the digital world. So, let’s get to work! Your dedicated Manager will be with you around-the-clock. We are Team Wegacha We get it. We got you. 
    2 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Luby

    Lubyverified-flag

    5
    (4 reviews)

    Welcome to Technology Applied right

    Recommended
    For 20 years, Luby has been digitally transforming companies in Brazil, the U.S., and Europe, scaling the ability to design and launch high-impact digital products through exceptional teams. International Presence +300 Talented Lubers +40 Mastered Technologies +500 Attended Customers +1000 Projects Delivered +20 Years in the Market We are a strategic partner to co-create successful digital products that solve real-world problems with high performance and agility. We serve from startups to medium and large companies in the digital transformation phase, with software solutions focused on business vision and execution capacity.
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • Lightspace

    Lightspaceverified-flag

    (0 review)

    We help brands launch and grow through technology and design.

    We are a US-based design and development agency working on projects around the world. We support businesses of all sizes throughout their journey from idea to launch, or by helping them elevate their business and scale. Our team is an international blend of creatives and tech experts, specializing in branding, design and development services.
    4 works in E-commerce
    Active in Miami, United States
    From €3000 for E-commerce
  • Gig Miami

    Gig Miamiverified-flag

    (0 review)
    Award-winner
      We are experts in the branding and e-commerce field, with a holistic focus on fashion, lifestyle, and wellness specialized brands. Our ambition is to cultivate a highly successful and integral brand experience to meet all of your business needs. At Gig Miami, we believe your business goals should be in alignment with well-crafted and effective digital communication. It is our promise to you that all of the services you require to promote your brand will be provided with expertise, love, and dedication that stands the test of time.   64% of consumers say that shared values are the main reason that they have a trusted relationship with a brand. Do you know if your website and marketing materials are truly aligned with your brand’s values? Running marketing campaigns or employing new strategies without getting your branding right first is like shouting at a brick wall. Why? Because your ideal customers aren’t going to listen if your brand doesn’t resonate with them. Branding is everything in business - especially in fashion. When done right, it allows you to connect with your ideal customers who identify with your brand values and aesthetic.   My expertise is to help brands create a beautiful visual identity with compelling messaging that communicates their brand’s values and connects them with their ideal customers, all without the big price tag that often comes along with it. If you’re open to learning more, let’s talk. Book a call with me and receive a free brand audit: https://calendly.com/gigmiami   Services,    Web design. Design and develop a website using Modern fonts. Up to 6 designed Squarespace pages Custom CSS added Responsive design Basic SEO added to website Graphics   Responsive E-commerce Design Design and develop a Flagship E-commerce Customized design for a unique brand experience Custom CSS Responsive design SEO added to website Curated Images & Graphics We have a strong experience with Shopify, Magento...   Full Branding Experience Brand Strategy Logo design Copywriting - Mission, Vision, Values Social media graphics, newsletter design, business cards Brand guideline PDF
    2 works in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • wdmarketingdigital

    wdmarketingdigitalverified-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    No work in E-commerce
    Active in Miami, United States
    From €400 for E-commerce
  • LeverX

    LeverXverified-flag

    (0 review)

    Innovate Today To Lead Tomorrow.

    Award-winner
    LeverX is an international company and a global system integrator that specializes in SAP implementation and customization. For over 20 years, it has been sustaining a reliable and reputable partnership with SAP. LeverX has deep expertise is based on successful cooperation with SAP as a Preferred Vendor since 2004. As an SAP Gold Partner and Global Strategic Supplier, the company helps companies leverage investments in SAP solutions. LeverX has delivered over 950 successful projects for 800+ customers. The key industries include manufacturing, automotive, telecommunications, healthcare, transportation, retail, financial services, etc.
    1 work in E-commerce
    Active in Miami, United States
    No budget for E-commerce
  • Perconvly Media

    Perconvly Mediacertified-flagverified-flag

    (0 review)
    Ecommerce Scaling Company for Proven Stores doing more than $15,000/month in Revenue. We focus on delivering High ROAS. Paid Media and Acquisition Experts, Digital Media Buyers testing and scaling products through Facebook Advertising, Native Advertising, Google Adwords and more. Conversion Rate Optimization Experts delivering  We scaled a brand from $32,000/month to $530,000/month in under 2 years From $110,000/month to $185,000/month From $2MM per year to $4.3MM in under one year
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • 6C Marketing

    6C Marketingcertified-flagverified-flag

    (0 review)
    We help our clients solve issues and concerns regarding their digital footprint. From brand positioning to lead generation, regardless of size of the company, the ideal customer is an organization that engages with us to solve big problems. Industries of Expertise We have provided our services to many clients from differents industries, however we believe we are best in the following areas: HealthCare Manufacturing B2B Ecommerce Services SaaS Our typical clients (e.g. startups, l arge businesses) Most of our clients are mid-sized Businesses in the US who want to optimize their current campaigns or are about to start a digital transformation. We also have a whitelabel service for Agencies. Skills & Experience We combine a set of different tools and skills, these include: Unbounce HubSpot Google Ads, Bing Ads, DoubleClick, Google WebDesigner Facebook Ads, LinkedIn Ads Google Analytics, Google Tag Manager WordPress, WooCommerce & Magento 2 Adobe Illustrator, Photoshop, InDesign Adobe After Effects InVision About Us We are a Detailed Oriented Marketing Agency based in Miami and Buenos Aires. We are Google Partner! Our Typical Process We prefer to offer a 30 min free consultation like an on-board call to get to know your business. Contact Us Our staff speak English, Spanish and French fluently and we reply almost instantly during our working hours.
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • MObeats

    MObeatscertified-flagverified-flag

    (0 review)
    We love solving problems while creating cutting-edge products and innovative experiences We love helping companies achieve their business goals and make great relationships with their users through purpose-data driven methodologies with custom technologies.
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce
  • DPL

    DPLverified-flag

    (0 review)

    Innovation as a Service

    DPL is one of the leading software development and IT companies around the world. Established in 2003, DPL serves customers in all major regions emphasizing most on Europe, Middle East and Americas. The company is based in Islamabad, Pakistan with its regional offices located in USA and Sweden. DPL is the pioneer in Agile practices and innovation culture in Pakistan. The company has been recognized globally in various magazines and rankings for its unparalleled workplace environment. The flat culture and holacratic approach encourage employees to work devotedly and stimulate innovations in the process. Clients from a wide range of industries including, but not limited to Healthcare, Fintech, Automotive, Mobility, Telco, Education, Media and E-commerce make a highly diverse portfolio at DPL. The services primarily include Digital Transformation, Product Engineering, IT Strategy & Consulting, and Custom Software Development. DPL leadership plays a crucial part in restructuring of the IT sectors in various regions of the world. The members of the executive team serve at the core of policy making and implementation of #DigitalPakistan campaign. DPL also hosts annual Agile Conference and serves to disseminate the knowledge and best practices in Agile transformation. Let's talk to identify the areas of mutual growth and collaboration.
    No work in E-commerce
    Active in Miami, United States
    From €1000 for E-commerce

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Firms specialised in ecommerce located in Miami!

Our team helps to smoke out the most adapted bureau in Miami.

Both here and elsewhere will our team manage to aid you encounter the best ecommerce marketing agency. Since our team knows a myriad of firms worldwide. Sortlist is therefore the optimal practice to set up a prosperous communication operation somewhere else as well as in Miami.

Sortlist helps you find the best agency in Miami

Looking for a collaborator in the region of Miami for your forthcoming marketing assignment? Do not lose lots of hours and reach out to us. Since ecommerce marketing agencies will provide a gigantic help for your e-commerce marketing or your e-commerce platform maintenance assignments.

For Sortlist it’s a reality, working together a bureau in Miami is an asset for your assignment in ecommerce.

Rely upon the skillfulness and the tips of your ecommerce marketing agency throughout the launch of your action and your operation will have a real imprint on your firm. This is because of  the fact that they have develop into experts in their field and ecommerce has no enigmas for those agencies!

Our list is made up of a profuseness of firms over the world, so if you are searching for a partner in Miami then we are convinced he is in our listing. You will, once your business has chosen its agency, launch an integral operationning to manage the activity of your enterprise.

ecommerce marketing agencies in Miami.

Because the ecommerce marketing agencies regularly operate with companies performing in the accounting- and even the household products sector they will, certainly, have the means to meet all your solicitations. You will therefore like a bat out of hell learn that every demand can be answered by a bureau technical in ecommerce in Miami.

We believe it is safe to say that starting an activity in e-commerce marketing or in e-commerce platform maintenance on your own can eventually grow into a tedious and pricey misadventure if your company doesn't execute it rightly. Don’t overthink it and hire a company in Miami to secure your profit!