The 10 Best Marketing Agencies in Madhya Pradesh (2024)

Best Marketing Agencies in Madhya Pradesh

Best agencies in Madhya Pradesh

  • 1 work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Redefine SEO

    Redefine SEOverified-flag

    (0 review)
    Award-winner
    Redefine SEO, a leading SEO, Business development company is a single source for what your business needs, they have the highly qualified and experienced team of SEO experts, having a good knowledge about both Social Media, On page  as well as off page techniques, which help them to understand the needs of their customers. Company overview: Redefine SEO, is an IT Company who deals in SEO Services; they serve you the best 100 % result oriented SEO Services at affordable prices, they can improve organic as well as paid traffic and leads with ease. Their Office is situated in Bhopal (India).Their customers include a wide range of companies, they won't believe in talking, their results may itself say everything, We understand the client landscape and provides the end-to-end solution approach that enables them with the complete lifecycle of the services.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Top 2D 3D

    Top 2D 3Dcertified-flagverified-flag

    (0 review)
    From our humble beginnings in 2007, Top2d3d studios is now a Private Ltd Organization with creative team of 50+ artists.  With head office in Lucknow, India and branch offices in USA, Dubai, Singapore and Australia. Company is debt free, bootstrapped and managed by top notch industry professionals.  Awarded by US Air force, Adobe, and Kicktarter for exceptional services in video production. We continue to drive harder each day to provide each client with surprising results.  Top2d3d Studios is the only studio in India which specializes in all kinds of video technologies including, motion graphics, explainer videos, 3D animations, visual effects for films, television commercials, music videos and Architectural visualization.  Our passion for excellence has kept us on the forefront of video making and leading the pack in innovation and technological development. This obsession was evident from the very beginning when we won the very first nomination for Best product placement techniques in 2008 (SuperStand Germany) - only a year after moving onto our current studio. Throughout our history, we’ve nurtured and aided world’s most legendary firms in video production, concept designing, marketing, for companies like Unilever, McLaren, Wella, AT&T, TCS, Infosys, Atkins, and Fuji Xerox had graced our lot in earlier years. In more recent times, our star power has only grown brighter as we’ve worked with Infosys, IBM, Nike, Cisco, American Government Projects, Aegis, NASA and many more. Our passion and experience combined with such talent has resulted in nominated by World Bank.  We are operating globally and it’s always fun to help people become one of the most talked about brands. Being engaging is one thing, being entertaining is another but motivating the viewer to make a change, to actually do something different, that’s what we aim for.  Website: www.top2d3d.com  Youtube:  Facebook: 
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Ingenious Folks

    Ingenious Folkscertified-flagverified-flag

    (0 review)
    Ingenious folks is an emerging creative advertising agency. Located in Mumbai, our company focuses on delivering high quality content to their clients. Whether you’re a newbie or you’re brand needs a reboot, we craft experiences that will help you soar to new heights. In a short period of time, we have managed to expand our client base Our ground-breaking expedition in the fields like web designing, print media, branding and re-branding, strategy planning, and providing business solutions is impressive. This approach applies to services such as Website Design & Development, Mobile Applications, Social Media & Online Marketing, S.E.O, Marketing Strategy, Video & Motion Graphics, Branding and Designing. We bring together insanely talented individuals from all walks of life, right from technical to creative, they are visionaries that focus on creating and nurturing innovative ideas Creative content development is our forte, which we demonstrate through performance.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Media Mantra

    Media Mantracertified-flagverified-flag

    (0 review)
    Media Mantra is a PR agency operating out of India which focuses on 360 degree PR and online reputation management. Some of our services are highlighted below   1. 360 Degree PR Solutions 2. Online Reputation Management : Social Media Management 3. Press Coverage | Media Coverage 4. Media Workshops and Media Trainings  
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • brand-comm is a leading brand consulting, public relations and digital marketing firm headquartered in Bangalore, with presence in seven other major Indian cities. We can help put your brand on track.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • EXL PR

    EXL PRcertified-flagverified-flag

    (0 review)
    For over 18 years, we have played a pivotal role in helping Startups, Emerging Enterprises and Multi National brands Go-to-Market in India. Our client-oriented approach, the best talent in the industry, a deep commitment to stay focused on deliverables and a keen desire to consistently exceed client expectations has earned us a reputation as a valued partner. We focus on brands, irrespective of their size, that demonstrate the potential to scale business opportunity over time and across geographies. Although we specialize in technology firms (business, consumer and future technology) over the last couple of years we have expanded our focus to include tech enabled vertical solution brands (edu-tech, fin-tech, transport-tech, telephony-tech, retail-tech, healthcare-tech etc). In addition, we offer specialist "Go-to-Market" services to multinational brands keen to enter and engage the Indian market. Some notable global brands we have helped enter the Indian market and grow profitably include Kingston Technology, Cytori Therapeutics, Belkin and AVG. We are a fully integrated, offline to online, services company. Our services stack, that we deploy in pursuit of client business goals, includes: - Content Development (text, visual and tech) - PR Campaigns (traditional and digital) - Digital Campaigns (organic and paid) - Consulting Services (go to market, research and channels marketing) Headquartered in Bangalore, have operational offices in Delhi and Mumbai and possess the experience and ability to execute client campaigns across all geographies in India.  
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • We are not a conventional digital marketing agency. We are not an agency at all, we are the path breakers and disruptors when it comes to the whole gamut of online marketing. In today’s world where online presence is taking many organizations really far, a lot of organizations in India’s Tier 2 cities are struggling in leveraging online marketing for the betterment of their businesses. The reasons:  1.      Lack of Knowledge about the Nitty Gritties of the Digital Landscape 2.      High Cost Barrier 3.      No 360 Degree Integrated Marketing Communication Plan 4.      Agencies care less about marketing and focus more on technology We at the communication hub believe in making Online affordable for small and mid-size businesses all over again. The key services essential for effective online marketing like content writing, designing, website management and analytics, search engine optimization, social media marketing, etc. are being provided through our carefully crafted suite of packages at more than 10 times lower prices than any other company.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • TheConversions is a full-service SEO company based in India, but delivering to customers across the globe and industries. It’s a consortium formed by 4 SEO professionals, each having 10 years plus experience. Our strong team of 50+ SEO experts have experience of handling over 2000+ clients. Our team consists of 20+ linguistic experts with absolute command over multiple International languages. We have 10 + highly trained and experienced and qualified staff to fine tune technical aspects of websites and to deliver high quality web solutions to global businesses. We leverage our knowledge base to deliver the finest and profitable solutions that meet customers’ needs. We explore your business and focus on optimising your web presence. Our team knows how to add real value to online businesses. We provide services to both B2B as well as direct clients. In B2B, we provide white label services to strengthen every single element of end client’s website. We devise and execute the most scalable and reliable SEO and conversion strategies to improve websites’ performance. Our SEO specialists adjust your clients website according to the norms to achieve maximum visibility and traffic. We also offer a FREE SEO CONSULTATION service and a comprehensive website analytical report to highlight key strengths and weaknesses of your website. We utilize advanced tools and techniques to provide you the cutting-edge solutions so that you can dominate the market and achieve optimum ROI. We have everything to win the battle, such as: Industry expertise (years of relevant experience) Managerial approach Smart team (business analyst, programmers, SEO specialist) Solid infrastructure (fully operational labs with advanced software suites) Linguistic capacity (20+ linguistic professionals) Technical expertise (10+ web development professionals) We manage all the dimensions of SEO to plan, organize, control and implement key changes to gain better result  
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • We are a full service digital marketing company and our services include: paid media, SEO, conversion optimisation, analytics, social media, content marketing, influence marketing, web Development and creative services. Our team’s diverse range of skills allows us to create dynamic, holistic and salable campaigns for all of our clients.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • DV Infosoft Pvt. Ltd .  is a proficient Software development and website designing company established at Bhopal. We impart a great number of software & website development services. It includes Web Development where we provide a total package of website development to help you boost your business. Till now, we have a huge quantity of effective projects to be delivered especially for Hotel’s Software. Web Designing is one among our key features in which best designs for higher customer satisfaction is provided to assist you enhance your business. Our first priority is to give quality services to the clients all over the globe on the basis of long term relationship. Graphic Designing is done where a mixture of imaginations, creative & brilliance stylizing are achieved. Imparting splendid services in distinctive fields is our sole objective. We believe in providing unique, wonderful and superb web solutions that gives us a positive testimonial from our clients. We have a dedicated team with an excellent blend of technical, professional, functional knowledge & result oriented team. We make sure our team is experienced, trained & possess skillful knowledge. We not only provide you a field of expertise but also are good at translating technology into valuable business websites & application. Our services are affordable, versatile & possess standard quality. We have scalable & organized inventory management & ERP system. We therefore take pride in both our business competence & strong technical skills. It’s built from the ground up, using the latest web technology in which our technical experts excel. We provide following services: # Web design & development # Websites (e-commerce and business websites) # E-commerce Portal and payment gateway integration # Mobile Applications #Barcode Solutions #Customized Software Development # Social Media marketing # Search Engine Optimization (SEO) # Pay Per Click services (PPC) # Online Reputation Management (ORM) # E-mail Marketing # Content Writing #Domain and Hosting Provider #CCTV and Surveillance Services #Bulk SMS and Whats App # Content Marketing # Video Marketing #Logo and Graphics Design #Social Media Optimization(SMO)
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • obabuji.com

    obabuji.comcertified-flagverified-flag

    (0 review)
    A Complete Customized Digital Marketing Company Game Changing Advertising We are an inventive full-service agency that specializes in Digitalizing brands. Our approach encourages deeper, more personal brand connections. obabuji.com is an integrated, next-generation agency with digital at its core focused on driving rich engagement for many of the world's leading brands. Ours is an entrepreneurial, solutions-based culture. We bring together the disciplines, technologies and creativity needed to "Revolutionize Relations" between companies and their customers.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Digital Bae

    Digital Baecertified-flagverified-flag

    (0 review)
    We're an independent branding and digital services agency with 8 years of experience in B2B and B2C brand management. We create winning branding solutions, using concepts that are strongly aligned to your corporate vision and values. Who We Are Digital Bae is an advertising agency providing full scale Social Media Marketing and Advertising Services. We are the believers in the power of web and marketing.  We use mixture of several web marketing tools to add taste of success to your business’s curry. We are clear with our mission: To generate demand for your product or service. Why Digital Bae? You deserve a firm that takes efforts to know about you, your industry and your customers. We analyse your business and built strategies that are exclusive to it. We customize orders based on requirements and promote products as well as Brands utilizing social media tools. Innovative Strategies For Ambitious Brands Digital Bae is a social media marketing company. The company has worked with many prestigious clients and delivered appreciable results. Out of the box approach and dedication towards completion of planned strategies makes us the most reliable of all.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Best Digital Marketing Company in Indore, Best SEO services Indore, Social media marketing services Indore - Affordable, Result Guaranteed Call: +91-7974881696
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • AM Webtech Pvt Ltd

    AM Webtech Pvt Ltdverified-flag

    (0 review)

    You Name It, We Have It!

    AM Webtech is a pre-eminent company focusing on various solutions from Web Development, Web Design, Mobile Application Development, Digital Marketing, API Integration to Quality Assurance & GiS Application Development to clients from all over the world.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Track All Digital AKA TAD is launched to help SMEs and Businesses specially which are small and have good business potential but have no or little digital presence. As we know technology is growing at the rocket speed, there is so much need for businesses to match that speed and adapt the current technology and algorithm changes. Be it Social Media platforms like Facebook, Instagram, LinkedIn, Twitter, Pinterest, YouTube etc. or be it Search Engines like Google or Bing, you would want your business offerings to be on the top when someone searches for you online so that they could find you and get your information. This qualifies your chances to grow your number of leads. We Believe In – “EVERY ONE IS PLAYING THE SAME GAME. BUT IN DIFFERENT WAYS”
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • INTELLARC is a versatile platform for all IT solutions. We have created a unique identity among thousands of organizations across the globe because of our performance. Our hard work, creativity, and skills make us a leading company in IT services. We are proud to collaborate with professionals IT software developers who are experts in providing services like Web Development, Mobile App Development, Software Testing, Cloud Service, Internet of Things, UI/UX Design, etc. We offer a wide range of services that has the potential to deliver valuable projects to the clients. "Creating value through turns your idea into reality". Website is the foremost part of any online business. So it has to be impressive, eye-catching and easy to understand. INTELLARC ensure the customers to render quality work at a cost-effective price. We keep profit-making aside and focus on producing quality projects. Although, we work with some conditions in which first priority is the satisfaction of the client. The only dream of our company is to make clients dream come true with our efforts.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Best Digital Marketing Training in Bhopal & SEO course in Bhopal, Offering SEM, ORM, PPC, SMM, website designing Training & development company in bhopal. Digital Marketing Company in Bhopal and SEO Company in Bhopal
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • About Pankhuri Infotech Pankhuri Infotech is a recognized company with presence in India but with clients across the globe. we have a team of experienced processionals which include web designers, developers . senior developers, graphic and UI designers , team leads and project management, in short, we are an established and growing web/App/software development and internet marketing company which has helped business succeed over word wide web.    Pankhuri infotech offering   CMS Website (wodpress ,joomla,Drupal,Magento) Software development & ERP development Mobile website & E-commerce development web application development  Design serviceS Internet marketing(SEO/SMO/PPC/ORM)
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Digital9X

    Digital9Xcertified-flagverified-flag

    (0 review)
    Digital9X, a leading SEO and PPC digital marketing agency in Bhopal. We’ll assist you with getting exceptional outcomes and produce more clients. We accept that the future of marketing is digital, and we can utilize a full scope of advanced showcasing administrations to help boost your online potential. Regardless of whether you offer to organizations or buyers, more visibility implies more leads and clients to your business. READY TO REIMAGINE YOUR BUSINESS? We help you stay ahead by optimizing digital marketing. In case you’re searching for genuine business development, SEO, or search engine optimization is the strategy for you. For what reason accomplishes it work? Straightforward! It focuses on the clients that are destined to change over on your website and takes them there.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Maven Cluster

    Maven Clustercertified-flagverified-flag

    (0 review)
    Maven Cluster is an award-winning IT company that helps you accomplishes great achievements with ease. Our Team of Top 1% of Industry Experts excels in leveraging the highly advanced technology to make your business profitable. With a legacy of 15+ years, Maven Cluster as an IT Firm delivers supreme quality in projects. We nurture your ideas into great enterprises with the ignited minds of our passionate team of developers, designers, and marketing expert. At Maven, We are offering the top notch IT services to the top level industries that includes- Website Application Development Custom Software Development Mobile App Development UI/UX Designing Digital Marketing MavenCluster thrive to empower you with the right technology to unlock your true potential. Experience the impeccable process of developing IT solutions to foster your business with Top 1% of Industry Experts; we create customized solutions especially articulated for our clients. We are focused on building a quality relationship with our clients that lasts longer. Get a free consultation with our IT expert today.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Kiaavi Technologies, a pure-play digital marketing agency specialized in Social Media Marketing, Social Media Advertising, PPC Ads, Leads Generation, Content Marketing, Mobile Marketing, Email Marketing and all forms of available internet marketing. It has a team of experts with experience of 12 years in industries who believe in providing world-class marketing services to deliver best results to our clients. Reach our experts to get a Free Digital Marketing Consultation for your business.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Graphic Bunnies

    Graphic Bunniescertified-flagverified-flag

    (0 review)
    Graphic Bunnies is a UI UX Design and Digital Marketing Agency based in Bhopal, India. We help brands and businesses in strategy, design, websites and marketing.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Marketerella

    Marketerellacertified-flagverified-flag

    (0 review)
    Marketerella is the finest internet marketing agency in India. We are a community of highly passionate young people who have mastered the art of making a brand stand out. We do so by offering a comprehensive business development package that goes beyond marketing. We work with our customers to design a website that beautifully represents their business. Create a logo that communicates what their brand stands for while still incorporating all of the other graphics that set them apart from the competition. Of course, we do not skip branding; we do so while keeping in mind that it correctly conveys the company's true essence. Each strategy is created and tailored to meet every specific need for our client's business growth. Our team of experts is committed to making their dream a fruitful reality and make their digital journey a breeze.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Zappian

    Zappiancertified-flagverified-flag

    (0 review)
    Zappian is a leading performance marketing agency based in Bhopal, India. To deliver value to business by providing quality leads, we work on various segments like email marketing, SMS marketing, push marketing, content marketing and media buying. We are proudly local and genuinely collaborative. Zappian works on Pay Per Lead and on Revenue Sharing Model. Grow with us. Call at 0755 400 9468 or visit https://www.zappian.com/in/
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Digital Screw

    Digital Screwcertified-flagverified-flag

    (0 review)
    We are an enthusiastic bunch of digital screws who continuously thrive towards meeting your goals and expectations. We provide digital marketing solutions such as social media marketing/search engine optimisation/ web designing and lot more. We currently have a clientele consisting of companies from healthcare, FMCG, e-comm, education, IT, pharmaceutical and hospitality sector. We have a 100% client retention and keeping them happy is our first priority.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Konvert Klicks Private Limited is a digital marketing agency in India. We offer our services to a wide variety of international customers, large and small to achieve online success. For more information, contact us at +91-9977001318 / 9993588111. We are a leading digital marketing agency in India, it’s a service-based agency that provides solutions to grow your business. The company expertise in the field of SEO, PPC, Social Media Marketing, Local SEO, Email Marketing, ORM, etc. Our team develops effective content strategies for forward-thinking companies. We have a proven track record in increasing search engine rankings.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Technogiq IT Solutions Pvt Ltd

    Technogiq IT Solutions Pvt Ltdcertified-flagverified-flag

    (0 review)

    Excellent IT Services and Consulting Firm

    Revolutionizing the world of technologies by offering excellent software development services. We started the small venture in 2015 with the name mitra infolabs and are happy to announce our new venture named  Technogiq IT Solutions Pvt. Ltd.  registered in 2019.  We are one-stop solution for any information technology services that a client aspires for. We focus on providing software solutions for startups, small and medium sized enterprises, businessmen and giant fortune companies. We’ve established our reputation in the industry through our commitment, team efforts and always aiming to offer the best services to our clients be it the end product or the overall experience with us. We have strong roots in architecture designing and developing services. Our sole objective is to provide solutions like - Open source development - Custom software solutions - Mobile applications - Digital marketing - IOT's - Cryptocurrency - Airtable - Business intelligence and analytics - Business process management - Cloud infrastructure implementation - Animation - Autocad - Sketchup And many other endless technology assistance.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • BBM Digitech

    BBM Digitechcertified-flagverified-flag

    (0 review)
     
    No work in Marketing
    Active in Madhya Pradesh, India
    From €100 for Marketing
  • DiGi MARK

    DiGi MARKcertified-flagverified-flag

    (0 review)
    DiGi MARK is a Premier digital marketing training institute in Jabalpur. It is one-stop solution for your all digital marketing training needs and to understand comprehensive details of digital marketing. Our all courses are crafted on a “Learn To Earn” basis. DiGi MARK has started with furnishing the training for digital marketing course in Jabalpur. After achieving fruitful success in workshops and classes, we have now decided to commence a well-developed digital marketing course which is given by the Google certified trainer and his team of highly qualified and experienced teachers. URL - https://digimark.institute/ Email: digimark53@gmail.com
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • technogaze

    technogazecertified-flagverified-flag

    (0 review)
    TechnoGaze Solutions is leading Digital Marketing Company in Bhopal & Raipur. The company has worked on several projects of Digital Marketing including SEO, SEM, SMO, SMM etc. 
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • DigitalPrarabdh, one of the best digital marketing company in Indore India, provide services that produce admirable and distinguished results, in short, directly helping companies to generate more leads and sales through our marketing techniques.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • vpadmarketing

    vpadmarketingcertified-flagverified-flag

    (0 review)
     
    No work in Marketing
    Active in Madhya Pradesh, India
    From €100 for Marketing
  • No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • About Syntax   Syntax to craft Mantra to relax Syntax Mantra is the only mantra that frames your business with a unique code of advanced technology, transformation, and innovation. Syntax Mantra moves ahead as a software development company that transforms business with its unique Coding Mantra and makes any business stand in the crowd followed by loyalty, transparency, and trust.   What we do!   Our true intention is to grow with you. We shake hands with every possible industry and drive the process with smart efforts in order to make any project worthy. Our hassle-free process just goes with the flow of: Brief | Action | Desired Results   What You Have To Do! Just sit back and let us chant this mantra for you and get the desired results.     Syntax Mantra Always coding roots Syntax Mantra is serving various industries with its extremely smart efforts and bringing its clients to the top with professional web design & development, mobile app design & development, and the best digital marketing services in India. With years of experience, the company has marked its footprints with 360-degree online innovative services.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Afzal Khan - Certified Digital Marketing & SEO Consultant

    Afzal Khan - Certified Digital Marketing & SEO Consultantcertified-flagverified-flag

    (0 review)

    Helping business to create and increase their Brand online!

    We’re a close team of Digital Marketing Strategists, SEO Consultants, E-commerce SEO Optimization & Social Media Marketing Experts, Graphic Designers & Web Developers who work together to create beautiful, engaging digital experiences. We help startups, large, medium and enterprise level companies from all over the world materialize their ideas into great success online! We tackle business problems with intelligence. We use cutting-edge tech and cutting-edge thinking to bring BRANDs to life online & direct consumer behavior. We take pride in delivering only the best.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Blackboard Edutech India Pvt. Ltd. is one of the best software and website development company in Indore. We provide services of school management software, responsive web application design, and development company, e-commerce website development, CMS website design, Digital marketing services, SEO services, SMS, web hosting services, real estate website design, and development at very competitive prices. We also provide solutions for local or small business websites and corporate website design and development. Our solutions will help you to grow your business to new heights.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • INFOCRATS Web Solutions Pvt. Ltd is a leading web development and designing service provider since 1996. We combine our experience and capabilities to provide services that help our clients in integrating the latest web and mobile technology into their business. INFOCRATS Web Solutions has a sister concern named Quacito LLC in San Antonio, Texas. We are a leading software development company in Central India. We are a bunch of super enthusiastic and expert teams to make business-oriented applications for our clients. Our cornerstone is to Improve the Efficiency and Productivity of businesses with our best services to our local, national, and international clients. Our tech solutions help businesses and organizations in enhancing their productivity.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Pristine Ideas

    Pristine Ideasverified-flag

    (0 review)
    We are a 360-degree advertising agency offering pristine ideas that make people smile, laugh, amaze and occasionally open their eyes wide! Brand Consultation, website designing, content writing, event management, PR & Marketing, Photography, Digital Media, Designing and SEO are a few of our services.,
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Web & Links Park

    Web & Links Parkverified-flag

    (0 review)

    Grow Your Business Digitally

    With an Aim to Take Your Business to a Higher Orbit of Growth Through Cutting Edge Innovative Services & Solutions, Web & Links Park is Now Open With a Wide Range of Digital Services Right from SEO, SEM and SMM to Digital Marketing, Branding and Design/UX.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Infocrats

    Infocratscertified-flagverified-flag

    (0 review)
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • SEO Agency in Indore - Brandstory

    SEO Agency in Indore - Brandstorycertified-flagverified-flag

    (0 review)

    seo company in indore, seo agency in indore, seo services in indore, seo services company in indore,

    Brandstory is one of the leading seo company in indore. We understand the importance of search engine optimization in the current scenario and will go to any length to improve your website's ranking. We have 12+ years of experience in SEO services in indore and are trusted by 500+ clients. We brandstory, top SEO Agency in indore offer search engines marketing advertising services like search advertising, display advertising, mobile app advertising, shopping advertising and video advertising. As a top digital marketing agency in indore, We offer the best SEO services in indore to all kind of business peoples like the small-scale business, medium scale business and large-scale business organization.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Identity MediaTech

    Identity MediaTechcertified-flagverified-flag

    (0 review)

    “Redefine yourself”

    We are not designer! We are creators… We Identity MediaTech a creative design and branding organization, work very hard and creative on your projects to establish a long-lasting class and mass effect as the DNA does to us. This is what our logo “The DNA Thread” inspires us to do. We always keep aspiring from excel towards excellence and are motivated by our Motto “Redefine yourself.” We live and breathe branding and design, which is the main area of our focus. In addition, our team members have many years of experience in the fields of marketing, advertising, web design, and computer programming. We're passionate about clients' success and go the extra mile to ensure ultimate satisfaction.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €100 for Marketing
  • DigiRank360

    DigiRank360certified-flagverified-flag

    (0 review)

    Show your business and grow your business..

    Digirank 360 is a Digital Marketing company based in the Prime location of M.P. Nagar, Zone-1, Bhopal. We provide Online Marketing services such as Search Engine Optimization, Social Media Marketing, Lead Generation, E-mail Marketing, Website design and development, and many premium services relates to paid advertising on Google, Facebook, and Instagram. You can consult with our digital marketing experts about marketing strategies that best suit your business, products, or services.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • QuikViral

    QuikViralcertified-flagverified-flag

    (0 review)

    Digital Marketing with Real Results

    Who We Are? Quik Viral is a leading provider in the Digital Industry with over 10+ years of experience. We are a team of creative minds looking to help businesses grow digitally and find the best solutions for you. We strive to integrate your goals with our goals. What We Do? Quik Viral primarily focuses on delivering Smart, Creative, and Customized Digital Solutions. Our digital marketing services include Search Engine Optimization (SEO), Search engine Marketing (SMM), Social Media Marketing (SMM), Graphic Designing, Email Marketing, Web Designing, Web Development & App Development, and E-Commerce Solutions. Quik Viral always presents your business ideas with creativity in front of your customers. At Quik Viral, we believe in delivering quality services that lead to desired results.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Infowind Technologies (IT) Pvt. Ltd.

    Infowind Technologies (IT) Pvt. Ltd.certified-flagverified-flag

    (0 review)

    Turning Tech into Asset

    Infowind Technologies believes that the software has the power to transform business insights in today’s digital era. Being the leading website and mobile application development company in India, we have empowered every business model whether it be start-up, small or mid-size organization, enterprise, or agency. Our crafted solutions have helped our clients achieve success and gain a competitive edge over others.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing
  • Web Development India

    Web Development Indiacertified-flagverified-flag

    (0 review)

    Award Winning Website Development Company in India

    Web development in India focuses on improving the digital experience of website users in order for business owners to increase sales. Web Development India offers PHP Development, Laravel Development, and WordPress Development, Website Development etc.Their high-quality, end-to-end Web developers are known for creating websites that are both sturdy and feature-rich. They make your company's website look professional and user-friendly. It is a well-known and reputable PHP Development Company, Laravel Development Company, and WordPress Development Company that has been serving the public for over a decade. Despite the fact that it is founded in India, it has built a strong and dedicated global clientele over the years. They never fail to deliver an above-average WordPress website in a reasonable amount of time. Their skilled pros can guarantee you a ground-breaking website that will increase your revenue by utilising cutting-edge technologies at all times.
    No work in Marketing
    Active in Madhya Pradesh, India
    From €1000 for Marketing

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.



Advertising Agencies in Madhya PradeshBranding Agencies in Madhya PradeshContent Marketing Agencies in Madhya PradeshCopywriting Agencies in Madhya PradeshDigital Marketing Agencies in Madhya PradeshEmail Marketing Agencies in Madhya PradeshEvent Companies in Madhya PradeshGrowth Marketing Agencies in Madhya PradeshInfluencer Marketing Agencies in Madhya PradeshMedia Agencies in Madhya PradeshOnline Advertising Agencies in Madhya PradeshPrint Companies in Madhya PradeshPublic Relations (PR) Agencies in Madhya PradeshSEO Agencies in Madhya PradeshSocial Media Agencies in Madhya PradeshMarketing Agencies in AucklandMarketing Agencies in Austin, TXMarketing Agencies in BengaluruMarketing Agencies in BerlinMarketing Agencies in Boston, MAMarketing Agencies in BrisbaneMarketing Agencies in CalgaryMarketing Agencies in CanberraMarketing Agencies in ChicagoMarketing Agencies in Columbus, KYMarketing Agencies in Dallas, TXMarketing Agencies in Denver, COMarketing Agencies in Detroit, ALMarketing Agencies in EdmontonMarketing Agencies in HoustonMarketing Agencies in IndianapolisMarketing Agencies in Jacksonville, ALMarketing Agencies in MelbourneMarketing Agencies in Miami, FLMarketing Agencies in MississaugaMarketing Agencies in MontrealMarketing Agencies in NashvilleMarketing Agencies in OttawaMarketing Agencies in Philadelphia, PAMarketing Agencies in PhoenixMarketing Agencies in San Antonio, TXMarketing Agencies in San DiegoMarketing Agencies in San FranciscoMarketing Agencies in San JoseMarketing Agencies in SydneyMarketing Agencies in Toronto