The 10 Best Innovation Consulting Agencies in the United States (2024)

Best Innovation Consulting Agencies in the United States

Featured providers

  • SEVEN

    SEVENcertified-flagverified-flagfeatured-flag

    5
    (7 reviews)

    🏆 Exceeding Your Expectations

    Award-winner
    SEVEN is an IT partner with time-tested expertise in solving complex software challenges requiring narrow specialization . One of our biggest strengths is finding unique approaches and solutions for startups and businesses from a wide variety of industries, including crucial ones like healthcare & education. We take pride in our ability to find the technical solution and ensure that it leaves our clients room for growth and protects them from undesirable financial and technological consequences. We apply our extensive expertise to anticipate the needs of our clients and suggest improvements from a new, fresh angle. With SEVEN, our clients team up not just with tech-savvy people but with a group of experts who know how technology influences the business and how to make it align with sustained growth in the future.
    7 works in Innovation
    Active in the United States
    From €1000 for Innovation
  • Linnify

    Linnifycertified-flagverified-flagfeatured-flag

    5
    (5 reviews)

    Simplifying life through innovation.

    Recommended
    Award-winner
    Linnify is the go-to digital product studio for transforming ideas within the Health, Education, Well-being, and Sustainability industries into successful and scalable products. We help bold innovators change the way people experience life. Simplifying life through innovation is our thing. And we do that by using a dynamic validation-driven process that is smartly adapted to the market needs. Founded in 2016 in Cluj-Napoca, Linnify developed over 60 products in more than 10 different countries, such as the USA, Germany, Romania, and the UK, to name a few. Projects involved: drd doctors online (Health), Readability (Education), Child Car Safety App (well-being), or Benefyd (Sustainability). At Linnify, the team follows a validation-driven approach to product development a nd has developed a proprietary process for early-stage startups or spinoffs called the  Essential Validation Playbook. This process seeks to answer if and how the market will embrace the idea. In addition to engaging the right stakeholders, the team generates meaningful consumer insights through interviews that provide quantitative and qualitative feedback to assess whether an idea can succeed in its respective market. With these validation efforts, the customer and Linnify can test hypotheses and deliver data-driven solutions for a more successful product or service launch. We have constantly expanded our perspectives and expertise to stay committed to your success every step of the journey. We are dedicated to understanding your vision, whether you’re in an exploration phase or have already started building your business idea. By building a shared vision, we can offer tailored expertise for your business needs. Join us to validate your product idea, prototype it and take all the steps needed to secure a successful start for your business. We truly understand the risks. We've gone through them ourselves. That’s precisely why Linnify is a partner that consolidates a scalable and dynamic architecture for your idea through validation while also being the place of exploring and building innovative solutions that recreate the universe we know with the universe we need. During the past 7 years, Linnify gathered over 50 experts: UX & UI designers | web, mobile, and backend engineers | quality assurance specialists | product success managers | marketing professionals | people and culture specialists. In 2022, we became official Google Cloud Partners.
    3 works in Innovation
    Active in the United States
    From €5000 for Innovation
  • 20ACTION

    20ACTIONcertified-flagverified-flagfeatured-flag

    (0 review)

    FROM IDEAS TO IMPACT!

    Award-winner
    Siamo un'agenzia di comunicazione integrata all'avanguardia, specializzata nel creare connessioni significative. La nostra expertise spazia dalla realizzazione di eventi dal vivo a formati digitali innovativi, passando per la produzione di contenuti, esperienze immersive e interattive. Grazie a un team internazionale di professionisti, sviluppiamo progetti cross-media che non solo espongono i contenuti dei brand ma li attivano in modi che risuonano profondamente con il loro pubblico. La nostra missione è trasformare idee creative in campagne e attivazioni avvincenti che esprimano i valori, la filosofia e i prodotti del vostro marchio, assicurando che ogni comunicazione spicchi nel saturato panorama mediatico. Le nostre strategie comunicative sono pensate per creare una connessione profonda con il pubblico, facendo leva su narrazioni immersive, tecnologie di punta e un costante impegno verso l'innovazione. Dallo sviluppo di concetti creativi a soluzioni strategiche mirate, il nostro approccio è sempre focalizzato sull'ottenere un impatto tangibile, dall'idea iniziale al risultato finale. Crediamo nel potere di una comunicazione che fa la differenza - dall’idea all’impatto!
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Nilecode

    Nilecodecertified-flagverified-flagfeatured-flag

    5
    (2 reviews)

    Product Innovation Management, Technical Consultation, Project implementation and R&D

    Recommended
    Award-winner
    Nilecode (Established in 2011) is a multi-service web solutions provider that caters to domestic, regional, and international clients. Made up of a team of ambitious youths who are in constant engagement with the latest of trends and the most advanced of technologies, the company not only offers the most adequate strategies and designs in accordance with the clients’ needs, but is also distinguished by the promptest of responses to all kinds of arising problems and/ or inquiries. Striving for innovation and motivated to produce the most creative of ideas, Nilecode  has since its inception been eager to address all the challenges that usually face companies working in the same field, which is demonstrated in its ability to build multi-lingual Systems, implement performance enhancement in small-scale projects, reach a standard of usability that overcomes common obstacles faced by internet users, and guarantee the highest levels of security in a medium where protection is of the utmost importance. Operating with a flat management system that evades work obstruction triggered by hierarchical tension and adopting an agile approach that generates a thriving professional environment, the outstanding efforts of Nilecode team members are exerted within the framework of an invigorating process that combines premium quality with boundless originality. Last but not least, Nilecode stands out amongst other companies in the way it offers first-rate services with the most affordable of prices, a strategy that has so far enabled us to maintain long-term relationships with clients who either come back for more support or who do not hesitate to recommend Nilecode to other potential clients in search of a reliable provider.               Nilecode is proud of producing more than 150.000 working man hours during the last year, and developing/ maintaining about 4.5 million lines of code.
    7 works in Innovation
    Active in the United States
    From €1000 for Innovation

Best Innovation Consulting Agencies in United States

Sort by
  • Process AG is a brand development agency who specializes in product based retail and online launches. This includes branding, retail outreach strategies, D2C and Amazon launches, and packaging development with full manufacturing and logistics management to get your products and packages to market. We maximize profitability for our clients and brands with expertise in business development, manufacturing, and brand design. We have the capabilities to make a significant impact on your brand.
    2 works in Innovation
    Active in the United States
    From €1000 for Innovation
  • Virtuosity

    Virtuosityverified-flagfeatured-flag

    (0 review)
    Award-winner
    Virtuosity is an awarding winning international agency specialising in 1. Brand development for new brands and startups 2. Brand Transformation for existing organisations 3. International representation and marketing Virtuosity has in-house capabilities and international team members with an exposure working with large brands such as: 1. Audi 2. BMW 3. Proche 4. Mercedes 5. Volkswagen 6. Virgin 7. Adidas 8. Nissan 9. DHL 10. Mahindra & Mahindra Ltd. 11. Mahindra Conveyors 12. Hoerbiger 13. Baker Gauges 14. Linfox 15. Boston Acoustics Virtuosity can provide a host of 360 degree solutions including: 1. Creative Content writing/ Technical content writing 2. Graphic designing 3. Web designing 4. Commercial photography 5. Movie production
    2 works in Innovation
    Active in the United States
    From €1000 for Innovation
  • My objective is to create a fantastic experience, innovative and effective for your business. I will walk you through every stage and handle the heavy lifting so you have more time to focus on your business. I am part of an agency with a small team of in-house developers and designers based in New York City, helping businesses worldwide. My resources will ensure a quick turnaround while maintaining high-quality work. My focus is on developing solutions specific to your business needs and goals. To ensure your project gets completed before the agreed due date, I scheduled my work weeks in advance when possible. Have a question? Let's set up a call, and can I provide you with advice on potential improvements. I am reliable, easy to work with, and will do my best to outline a clear project scope during our initial conversations to make sure I can deliver what you need from beginning to end. In the last two years, My team and I have helped optimize over 75 businesses, increasing their number of customers and boosting conversions. My clients have seen their onsite conversions increase up to 40% after their website's rebranding. I help online business owners discover valuable insight that increases their profits and do my best to provide the highest possible ROI. Sites Examples: ★ licorice.com ★ bcdevices.com ★ bloomist.com ★ schuilcoffee.com ★ beeandkin.com ★ pinkdoorfabrics.com Custom Feature Examples: ★ Bundle Page - licorice.com/products/create-your-own ★ Subscription Box - irvingfarm.com/pages/coffee-subscription ★ Bundle Page - schuilcoffee.com/pages/coffee-sampler ★ Collection Category Page - schuilcoffee.com/pages/single-origin-blends-decaf ★ Custom Product Form - unityinglass.com/products/lee-ware-unity-sculpture ★ Ingredients Glossary - pausewellaging.com/pages/ingredient-glossary/ Here is what I have experience in: Store setup: Store build or redesign | Store migration | Custom pages and forms | Custom cart and checkout | Currency selector | Custom navigation and search | Website access control | Set up custom domain Settings configuration: Payment settings configuration | Shipping settings configuration Product and collection setup: Product setup | Product and collection pages | Subscription products setup Custom visual elements: Buttons and badges | Images and visual effects | Custom banners, headers, and footers | Custom fonts Development and troubleshooting: Integration with another system | App installation | Custom app development | Migration of existing app | Custom theme design | Custom features or code | Custom commerce experience | Troubleshooting
    2 works in Innovation
    Active in the United States
    From €1000 for Innovation
  • Mountainise Inc

    Mountainise Inccertified-flagverified-flagfeatured-flag

    5
    (2 reviews)
    Recommended
    We are amongst the early birds’ who foresaw the revolution that technology was about to stir in digital marketing. Therefore, we started incorporating Artificial Intelligence (AI) into our problem-solving process to augment our analytical abilities in 2014. We overcame innumerable industrial challenges and resiliently adapted to dynamically changing digital environment along with timely adoption of technological innovations, establishing us the uncontested market leaders. Since then we have served a wide-variety of mid-sized to Fortune 500 companies including Financial, E-Commerce, Insurance, Self-help, Education, Tech and B2B/ B2C industries. Mountainise aims to enable companies to make better business decisions by capitalizing on advancements in Artificial Intelligence and embedding AI technologies like machine learning solutions across Omni-channels while improving customer satisfaction. We drive to get to market faster, simplify complicated business processes, and solve more problems with less money. AI focused Marketing solution provider. We have developed Lucrative, a most powerful AI ever built for Digital Ads Intelligence. With Lucrative you can save upto 35% of your wastage ad spend and increase your ROI.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Alfatek Digital

    Alfatek Digitalverified-flag

    4.8
    (2 reviews)

    ATD is an agency committed to bringing brands to life

    Recommended
    A Data-Driven Creative Digital Marketing Agency Focused on Delivering Real Results, Alfatek Digital (ATD) is a premium digital marketing company comprised of a team of creative designers, skillful developers, and top-notch digital marketing specialists. We offer tailor-made websites and digital marketing solutions that help you identify, reach out and engage with your target audience in unique ways. Leveraging the knowledge and experience of our team, we strategically build and share the brand story that is a true reflection of your values and business. Moreover, we increase your brand visibility, boost traffic, generate leads and sales while building loyalty through our cutting-edge digital marketing strategy. Through our innovative digital results, we put your brand on the top of your game.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • GeekyAnts

    GeekyAntsverified-flag

    (0 review)

    Research. Build. Collaborate.

    GeekyAnts is a design and development studio that specializes in building solutions for web and mobile that drive innovation and transform industries and lives. They hold expertise in state-of-the-art technologies like React, React Native, Flutter, Angular, Vue, NodeJS, Python, Svelte and more. GeekyAnts has worked with around 500+ clients all across the globe, delivering tailored solutions to a wide array of industries like Healthcare, Finance, Education, Banking, Gaming, Manufacturing, Real Estate and more. They are trusted tech partners of some of the world's top corporate giants and have helped small to mid-sized companies realize their vision and transform digitally. They provide services ranging from Web & Mobile Development, UI/UX design, Business Analysis, Product Management, DevOps, QA, API Development, Delivery & Support and more. In addition to that, GeekyAnts is the brains behind React Native's most famous UI library; NativeBase (15000+ GitHub Stars), BuilderX, Vue Native, Flutter Starter, apibeats and hold numerous other Open Source contributions to their name. GeekyAnts has offices in the US (California), India (Bangalore), and the UK (London).
    2 works in Innovation
    Active in the United States
    From €1000 for Innovation
  • Rapidops Inc.

    Rapidops Inc.verified-flag

    (0 review)

    Transform your Ideas into Digital Products

    Award-winner
    Rapidops is a digital transformation company that helps clients launch advanced digital products and platforms. Founded in 2008, it has worked with global companies in the retail, healthcare, and technology industries. The company offers product development, engineering, and analytics services. It helps clients design, engineer, and launch digital products and platforms that enable them to thrive and achieve more for their customers. Rapidops has a team of experienced professionals who are dedicated to helping clients succeed. The company is committed to helping its clients grow and compete in the digital age.
    2 works in Innovation
    Active in the United States
    From €5000 for Innovation
  • Appluex

    Appluexcertified-flagverified-flag

    5
    (2 reviews)

    UIUX Design, Full Stack Development, Mobile App Development, Testing, Quality Assurance, and Consult

    Appluex offers continuous deliveries following the Agile&Scrum framework. We pick your ideas from scratch, provide development solutions and meet delivery deadlines. Our services include UIUX Design, Full Stack Development, Mobile App Development, Testing, Quality Assurance, and Consulting. Our highly skilled team allows us to give our clients the opportunity to select their preferred technologies to meet their goals. You pick the Wand; we do the Magic! HIPAA and GDPR compliant!
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Grayphite

    Grayphitecertified-flagverified-flag

    (0 review)

    Engineering the Future with AI.

    Grayphite is an innovative software development company with global reach. Our reliable, scalable, and secure solutions leverage cloud and AI technologies to drive business growth. We tailor each solution to meet your unique needs, whether it's a new website, mobile app, or complex enterprise software. Contact us today to learn more about how we can help your business thrive. Our core skills include: AI based solutions Web application development Cross-platform applications Multi-tenant applications Bespoke software solutions Payment gateways Automation Contact us at services@grayphite.com to discuss your requirement now.
    2 works in Innovation
    Active in the United States
    From €1000 for Innovation
  • JetBase

    JetBasecertified-flagverified-flag

    (0 review)

    Crafting Your Tomorrow, Today

    Award-winner
    Take care of strategic matters, as we keep you connected during software development, testing, design, and analysis while you scale your business. For those who deal exclusively with experts. Achievements: 🦾 100% Job Success and Top Rated+ status (among the top 3% of agencies on Upwork) 🦾 More than 10 years of experience in Software Development 🦾 30+ engineers and more than 60 projects Benefits of Working With Us 👾 We are team players ready to collaborate with an existing team or create one for you from scratch. 👾 We strictly adhere to the agreed flow. Everything that is on paper is the number one obligation for us. 👾 Smart communication. We speak two languages: human and technical. We are ready to become an accurate interlocutor if you speak technical language, and an incredible translator if you speak only human language. 👾 Really deep technical knowledge. Our CTO has 10 years of experience in software development. The CEO has 15 years of experience. These numbers are quite convincing, so imagine what your project can become if you develop it with such pros. 👾 Honesty. We do NOT offer solutions that you don't really need. It is important to us that you get exactly what you need. 👾 We are in touch. Write to us and we will answer you. Ignoring and delaying is definitely not about us. Solutions: ❇️ Custom solutions: AWS / SaaS / ERP / CRM & iOS / Web / App ❇️ MVP ❇️ VisionOS App Development ❇️ Shopify apps ❇️ Full development cycle from scratch ❇️ Project architecture ❇️ Project management ❇️ Full after-launch maintenance ❇️ Project refactoring according to modern standards Modes of cooperation: 🏆 Team Expansion - strengthen your existing team with several top-notch specialists. 🏆 Dedicated Team - create a team from scratch for your needs with us. Hard Skills: 🟧 Front-End: React.js (Next.js) / Vue.js (Nuxt.js, Vuex) / TypeScript / PWA / Angular 🟧 Back-End: Node.js (NestJS, ExpressJS) / Rails / Django / Flask 🟧 SQL & NoSQL databases 🟧 Databases: MySQL / PostgreSQL / Redis / MongoDB / DynamoDB 🟧 Design: Web & Mobile Application Design, Landings, SaaS Design, Dashboards, Wire-framing, Prototyping, User Flow 🟧 DevOps: Cloud solutions using AWS (EC2, S3, Lambda, DynamoDB) and Google Cloud Platform. CI/CD - Jenkins, AWS Codebuild, GitLab 🟧 QA: robust E2E automation tests, CypressIO, Jest.js 🟧 Project management: Agile (Scrum, Kanban) Fields and Industries: 🧩 Healthcare 🧩 Real Estate 🧩 Media 🧩 Lifestyle 🧩 Cybersecurity 🧩 E-commerce 🧩 Education 🧩 Logistics 🧩 Energy 🧩 Marketing 🧩 Smart Home Contact us today to find the right solution!
    2 works in Innovation
    Active in the United States
    From €5000 for Innovation
  • Criterion Global

    Criterion Globalcertified-flagverified-flag

    (0 review)

    Innovative growth strategy for ambitious brands.

    Award-winner
    The leading independent, international media buying agency + in-house media consultancy. Technology + Tenacity for a global media marketplace.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • SalesboxAI

    SalesboxAIcertified-flagverified-flag

    5
    (1 review)
    SalesBox is an AI driven Customer Engagement Platform that helps you engage with your customers via digital channels like Email, Web, Chat, Facebook, Text & Call and generate Sales Traction for your Business. Our omni channel AI driven sales assistant helps you engage in personalized conversations with your customers and accelerate sales. When you partner with SalesBox, we provide you with the technology, services and know how to generate Sales Traction for your Business.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Augentia

    Augentiacertified-flagverified-flag

    (0 review)
    Augentia is a modern marketing company that offers specialized marketing services for enterprises, by augmenting our client’s product & services marketing efforts, data & technology effectiveness and industry resonance to enrich customer experience. Practice Areas Augentia redefines end to end marketing practice cycle in a dynamic manner and maps it to agile realities. We have deep domain expertise in the marketing areas that are of topmost concerns to marketers worldwide. Our marketing professionals, technologists, consultants & creative teams provide a strategic perspective, for the modern tech-savvy marketers. Marketing Automation - Trained and certified in various Marketing Automation platforms such as Marketo, Oracle Eloqua, SFDC Marketing Cloud, Mautic & others. We provide implementation & campaign support services on these platforms. Marketing Strategy - Perform market research, Prepare Marketing and GTM plans, Thought Leadership Product Marketing - Positioning, Messaging, Content Marketing, Marketing Collaterals [Brochure, Website, Presentations] Marketing Execution - Campaign Management, Digital Marketing Engagement Services Augentia is a pioneering effort to provide simple and flexible marketing services, with a customized touch by our experts, through the cloud. Agile and iterative, our service portfolio and engagement model caters to the dynamic needs of our clients. Project Based Delivery - Fixed price, milestone based with clear scope and outcomes Managed Delivery - Agile & Iterative, Mix and match resources on monthly basis with various skillsets. Combination of Consulting, Technology and People. Delivery Models Our Virtual Marketing Center (VMC) is the heart of Augentia operations. It houses seasoned marketers, backed by high-tech environment and proven processes, to render services to our clients worldwide. The VMC enables services delivery, and provides a framework to offer innovative packaged marketing practices that contributes to your business growth. Scaling up or down your marketing intensity, depending on your business needs and budgets, has never been so easy!
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • adCookie

    adCookieverified-flag

    (0 review)
    Award-winner
    NOT JUST A DIGITAL AGENCY BUT A PART OF YOUR DIGITAL TEAM. adCookie is a team of digital-enthusiasts who believe in the exceptional power of digital. We help brands all over the world to overcome their marketing challenges. Check our clients' reviews to make sure we do our best when it comes to satisfaction and quality. Our digital experts create complex PPC campaigns using the whole potential of Google Ads and Facebook Ads to improve your brand’s results. If you want to have a good first impression on your customers cooperate with us on your website as we build only effective and user-friendly ones. We believe there are no average results as well as average brands and are ready to prove it. Let’s talk if you share that view! OUR PHILOSOPHY:  WE LOVE BRANDS WE WORK WITH  We treat the digital challenges of our clients like our own, so we put 100% of the effort into everything we do. Perceive us as a member of your digital team, who is fully involved rather than just a digital agency. WE HAVE AN INDIVIDUAL APPROACH TO EVERY CLIENT  We adapt to the client's organization needs. Thanks to our media planning and design in-house teams we can offer various services tailored for client’s needs: strategy creation, branding, online campaign planning and execution, social media management or website creation. WE ARE COST-EFFECTIVE  Not only we have very attractive prices, but we also do our best to optimize your campaigns and spend your money wisely. WE DO NOT MASS-MANAGE CAMPAIGNS  Every campaign in adCookie is personalized according to the client’s business challenges. We make sure that our specialist takes as many campaigns as he can handle at its best. WE CODDLE OUR REGULAR CLIENTS  Once in 6 months we arrange training for clients on new trends in digital and send reports on changes in their industry and competitors’ online activities.  
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Man-sours

    Man-sourscertified-flagverified-flag

    (0 review)
    All companies big or small need strong social media advertising presence. We first create a strategy that aligns with your success metrics, which dictates the concepts for the videos and images. We are certified in popular social media channels to manage the distribution of the campaign. This allows us to split-test different visual variants across platforms (duration, CTA placement, messaging, etc.) which will improve budget allocation and campaign performance. Yes, we’re creative enough to not trust our creative minds and use data!
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Dilly Digital

    Dilly Digitalcertified-flagverified-flag

    (0 review)
    Best Award Winning Digital Marketing Company with Offices In 7 Countries Provided services : SEO , PPC Management , Social Media Marketing ,  Digital  Marketing , Content Marketing , Local SEO , Web / Mobile Design ( UI/UX ) with highest client satisfaction  Digital  Marketing company USA, Canada, Finland, Norway, Sweden, Kuwait, GCC. Data Driven Digital Strategy with Complete Business Audit.    Get Free No Strings Attached Business Audit. Absolutely Free contact us @ www.dillydigital.com 
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Techuz Infoweb

    Techuz Infowebcertified-flagverified-flag

    5
    (1 review)
    Award-winner
    Established in 2013, Techuz is an eminent name in IT industry. Our team of dexterous professionals offer a wide range of services such as UI/UX design, web & mobile app development, Javascript, IOT and Blockchain development. A little more about Techuz Established in 2013 with a passion to help startups built their dreams and enhance the established business, Techuz is now a top web and mobile app development company . The key areas of our expertise include web development , Android app development, iOS app development, IOT and Blockchain development. Techuz is also one of the finest JavaScript development company in the market. Our JavaScript services include Angular, React, Vue.js and Node.js development. With the philosophy to deliver promises and top-notch quality services, we have been recognised as a trusted partner by our clients around the globe. Services we have catered to our happy clients include: Web development services (Wordpress, PHP, Laravel, CodeIgniter) Mobile app development services (Android, iOS, Wearables, React Native) JavaScript development service (Angular, Node.js, React, Vue.js, Meteor.js) Web and mobile UI/UX design
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Magnetic Mango is a collaborative startup based in Panama City, FL dedicated to providing services that build visibility, awareness, and trust for our clients. We believe that businesses of all sizes – and budgets – should have the opportunity to access unique solutions to their needs. We’re a team of creative marketing, business development specialists, and reputable freelancers who help our clients produce enhanced, more relevant strategies and tactics. We focus on three pillars to live by, work by, and achieve by : These three pillars form the foundation for everything we do on behalf of our clients. We rely on these values to drive mutual success for our company and theirs. Through honesty, loyalty, and respect, companies of all sizes – and budgets – can have the opportunity to access unique solutions to their needs. When clients succeed, we succeed. Honesty As with any successful partnership, we will always be fully transparent with you. Honesty is the first, most essential of our three core pillars. We will let you know up-front what we’re doing, why and how we’re doing it– and how it’ll affect your bottom line. Loyalty We believe that opportunities are everywhere, and will continually explore new ways to resolve our clients’ needs. We maintain our loyalty by asking relevant questions to seek out the best options for our partnerships. Respect Environments, expectations, targets, goals, ideals– and even budgets– can change. We respect our clients and are flexible enough to change with them.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Cuaround, LLC

    Cuaround, LLCcertified-flagverified-flag

    (0 review)
    Cuaround, LLC recently transitioned to an app development agency. A team of four highly capable engineers and designers to tackle your project needs. How we approach your mobile development: Sleek modern designs done in-house by the founder. From the beginning stages of a project, we make sure aesthetically, the design is seamless and pleasing to the eyes. Whether it's a small project or big one, our designing approach will never change. Our development team make sure to seamlessly develop codes that coincide with the beauty of the app design.   Our parent company DRC CONGO INVESTMENT LTD is a new investment ltd company founded out of Belgium. Our parent companies approach is to invest in worthwhile disruptive projects that has the potential to scale worldwide. Currently, DRC CONGO INVESTMENT LTD  has invested in a  unique community blockchain platform that simply lets you snap, upload your personal property and it's insured for $5.00/month . To follow more on this, visit: https://www.drcinvestment.com We also have an office in New Jersey, USA.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Blink UX

    Blink UXcertified-flagverified-flag

    (0 review)
    Founded in 2000, Blink is a user experience strategy, research, design, and development firm dedicated to helping clients achieve their business goals through a flexible user-centered design approach. Blink has worked with hundreds of innovative clients ranging in size and type, from startups to Fortune 100, including Amazon, Apple, Disney, NASA, Google, Starbucks, and Microsoft. Blink has offices in Austin, Boston, San Diego, San Francisco, and Seattle. Blink also owns Insight Space, a Seattle-based research recruiting and focus group company. To learn more about Blink, please visit blinkux.com.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • STORY Kass Tech Consulting Solutions , LLC (Kasstechcs) is a full-service digital marketing agency that fuses technologies, strategic marketing, and creative services to unzip your vision to the world. Our mission is to make branding, marketing, and web design services affordable and accessible to as many entrepreneurs, small business owners, and non-profit organizations as possible. And, we intend to live up to our mission. As a team of believers, visionaries, and innovators we’re enthusiastically determined in our pursuit in revolutionizing technology at every turn; committed to providing creative services and business solutions affordably and with a positive vibe.   EXPERTISE E-commerce High end digital commerce websites to boost your sales, CRM, and ROI using creative and industry standard technology.   Business Boost Using Ads, SEM, Analytics, SEO, and many other innovative driven business technologies, we bring an influential boost in your business.   Creative and Graphic Design Professional graphic design services make your business stand out in the crowd. Our unique and creative design experts can apply your brand to every facet of your business. Strategic Online Presence As a pro-active agency, we offer the best in website development to best suite the dynamic needs of anyone, business and organizations across the world, using simple yet cost-effective technologies.   Social Branding Get your products and services influenced by our social branding and marketing experts using effective algorithms to fully optimize your online social presence. Digital Markteting Get professional tips on matters regarding digital marketing, ROI, CRM, Ad Campaign and more to boost your business.   Enterprise Consultation Get informative insights regarding how to best optimize your startup, organization, educational and business needs to best meet your satisfaction. Personal Branding Personal (individual) branding is a top-notch phenomena most individuals who are branding their business forget to apply, contact us to begin your personal branding for you.   Social Consultant Get  information and insights regarding how your products and services are influenced by our social branding and marketing experts using effective algorithms to fully optimize your online social presence Cognitive Chat-bot Development Conduct a conversation via auditory or textual methods, sell a product or service, optimize your flow using artificial intelligence and cognitive technology to meet your demands.   Data Analytics Use industry platforms and framework to analyze raw  data,  in order to make conclusions  and informed decisions driven by insights. Mobile App Development Using innovative technologies, we offer expert development regarding android apps, and iOS mobile applications with uniquer UI/UX .   Cyber-security Solution Using incident Response Platform, recognizing threats and malware infected files, your enterprise and business can minimize attacks while uncovering patterns. Digital Ads Using the International Ads platform, our team of professionals can put your products and services on the world map, increasing your revenue and brand name.   Search Engine Marketing Use search engine to market your products, services, brands and other business you have to achieve your aimed objectives Search Engine Optimization -SEO Ranking your website on search engines has never been easy. Thanks to our reputable SEO strategy and approach we enable any search engine rank your site accurately.   Landing Page Marketing We use professional landing pages (a.k.a Sales Page), to sell your products or services to a dynamic audience.   CLIENT We are known for providing results that move the needle. We have helped businesses break through the confusion of the Internet and of search engine marketing. Our top-notch solutions help attract prospective clients, convert those clients, and grow revenues. Our campaigns are measurable, and we track every click, every call, every Brand Marketing lead, so clients know that their marketing dollars are working hard to bring in more business. Our deep knowledge of varying industries allows Kasstech to execute high-impact digital marketing campaigns and generate quality leads. Our proven success in these industries sets us apart from other names in the digital marketing space. We have served top industry clients such as: Campus Royalty, Alvan Villa, Rova Media Inc, Rebirth Magazine, Allure Management and even more!   OUR PRINCIPLES Integrity We communicate openly and honestly in all of our actions. Building relationships based on trust, respect, and caring. We’re not perfect, but we won’t stop until we get it right! Client We recognize that our existing and prospective clients are at the core of our success. We support our client’s success by creating an exceptional experience through our innovative approach, cutting-edge technologies, and cost-effective solutions. Excellence We relentlessly pursue to improve our performance continuously and strive to be the best in everything we do. Teamwork We work together effectively to achieve our goals, while encouraging individual contribution and responsibility. Accountability We are accountable – individually and as a team – for our behaviors, actions, and results.  
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Fusion is a Strategic Design Partner. We believe in design strategy without compromise; delivering transformations that create value, bring results, and influence behavior. We provide branding, design and development services across the spectrum for digital, traditional and experiential content. We believe that great design drives business, improves lives and makes a difference.   Do you know how your customers are interacting with your brand? How they’re using your site? Are your employees achieving their best with the tools you’ve provided? How about your sales force? Are there things you could be doing to increase your conversion rates? Are you really seeing a return on your digital communications and social marketing? Companies that make an investment in strategic design are in a much better position to answer these questions and succeed in the marketplace. We’re here to help. Great Design is at the heart of all that we do; from our strategy, to our approach and our service promise. In today’s sea of constant change, well-designed solutions drive business forward and deliver results. Let’s design something great together.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Occurrent Arts

    Occurrent Artscertified-flagverified-flag

    (0 review)
    Occurrent Arts is a creative studio in Williamsburg, Brooklyn. We've been concepting, designing, and developing interactive experiential works for other agencies and major clients since 2011.   In today's economy, consumers value "experiences" over "commodities."  Accordingly, companies of all sizes and types have begun to analyze and redesign their customer journies; from advertisement to unboxing.  We understand the art of the experience and craft memorable moments as our trade. We believe that with the use of viscerally engaging techniques ( narrative, immersion, music, interactivity ), works can have a greater impact, allowing brands to develop deeper and more meaningful relationships with their customers. We pair top tier design talent with state of the art hardware to concept and previsualize works so clients know exactly what they're getting.  Using the Unity3D game engine we transform those designs into custom apps of all types which can be used for site specific experiences or deployed to any app store. We're always looking for new opportunities to explore the dimensions of idea with visionary clients.  Check out our portfolio to see examples of our aesthetic and conceptual sensibilities, and reach out to us if you need a hand.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • UppLabs LLC

    UppLabs LLCcertified-flagverified-flag

    (0 review)
    Developing secure and compliant software for Fintech, Healthcare and Real Estate. For tech business eager to be #1 in their niche In UppLabs, we are a FinTech solution provider and software development company with a particular focus on Lending Tech. We are the first software company that has created its own reusable solutions that help us develop custom finance software in a quicker and more efficient way. We have 10 solid years of experience on the global market,  with more than 1000+ successful deployments of our out-of-box solutions, 150+ deployed projects, and 50+ successful setups of dedicated development teams projects behind our back. The company was created by a CTO who has been working with the world’s largest fintech companies such as Deloitte or Citibank and wanted to apply the best practices of the leading finance software in his own very niche-specific software business.  We worked on Tax1099, digital banking of Citibank, full development of Recap Investment platform to name a few. At the moment, the company counts 100+ fintech geeks and a full-cycle capacity of handling software development projects from Business Analysis to DevOps. To facilitate the development of finance software, we offer a set of template (reusable) solutions to resolve our clients business problems connected with: KYC (LIVENESS DETECTION, BANK ID, IDENTIFICATION) RISK/SCORING SOLUTIONS CREDIT AFS & COLLECTION LOAN SERVICING SITEKITS/MARKETING TOOLS P2P FUNDING SOLUTIONS 3D PARTY INTEGRATION SOLUTIONS This helps cover some major scope groups in a month – where development from scratch could take 6 or even 12 months. UppLabs is a US-based company with R&D center in Kyiv, Ukraine, that works with clients worldwide. Most of the clients come from the 
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Malqart

    Malqartcertified-flagverified-flag

    4.6
    (1 review)
    Recommended
    With 112+ Million B2B leads, cutting-edge marketing, sales, and a multilingual sales team to recruit and manage your sales development and localization efforts, we know that Malqart is what companies are looking for to expand nationally or globally.   We create and manage multilingual websites, paid advertising campaigns, marketing collateral, and more to better inform your audience and hence shorten your sales cycle.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Recommended
    Stridely Solutions is a ISO 9001:2015 certified global Enterprise Technology solutions company. We are a family of 200+ multi cultured and multi talented passionate and well experienced resources who consistently work to set new standards of our quality delivery with cutting edge technology and well implemented software development processes. We have blended our 12+ years of rich experience of automating business processes and technology platform migration, by leveraging technical excellence with committed techno-enthusiasts to provide quality software solutions that can be used to generate a favorable return on your investment. We are a one stop solutions provider to our global customers with our bouquet of services and key offerings around Microsoft Dy/Ax/360, CRM, SAP, IoT, BI and Data Warehousing, Enterprise Mobility and custom application development. Quality with Timeliness has become our trademark. Our global footprints boasts of clientele in 20+ countries, 5 offices and development centers in 3 countries, 12,500+ man hours of rich experience across technology platforms and industrial domains, 24x7 critical support through helpdesk, are some of our key highlights. Our rich experience includes serving customer across variety of industrial domains viz. Manufacturing, Healthcare, Education, Retail, Sales & Distribution, FMCG, Logistics, Energy & Utility, Real Estate and Media Publishing.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Ink, Inc. Creative Group is a full-service marketing agency operated out of Brooklyn, NY. We specialize in matters of strategic messaging, branding, and digital marketing services for businesses that range in size from the very small to the very large. We remain focused on the intersection of strategy and creativity to drive successful client results. This holistic approach enables us to generate innovative, cross-channel solutions tailored to the unique needs of each client and their current competitive landscape. Our goal is to get your message out there in a way that speaks directly to your targeted audience, driving more conversions that will help your business grow.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • RF Studio

    RF Studiocertified-flagverified-flag

    5
    (1 review)
    Recommended
    RF Studio is a multidisciplinary digital agency based in Boston. Let our Growth Marketing Services fuel your business. We are a house full of Digital Gurus!
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • https://futurealiti.com/

    https://futurealiti.com/verified-flag

    5
    (1 review)

    Website and App development solution for transforming and innovating businesses.

    Recommended
    Futurealiti is a leading software development and Industrial Automation company working in various fields of IT & helping businesses and industries with technological acceleration. We are providing services in game development, industrial automation, character design, augmented reality, virtual reality, Extended Reality, the metaverse, and more. Futurealiti has achieved some remarkable goals within few years and inspired hundreds of our valuable clients from all around the globe by making their ideas into reality. In 2016, Futurealiti started with team of two. Now we have 200+ enthusiastic team members who are working hard to compete big challenges of future world which makes us one of the best IT and Software company in United States.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • LogoChemist

    LogoChemistcertified-flagverified-flag

    5
    (1 review)
    Recommended
    LogoChemist is a well known Logo Designing and Video Animation Agency in the United States of America. Our Web Development Services comprises highly passionate and creative developers, marketers, and website designers that blend in all of their expertise for meeting the requirements of the clients and deliver a broad range of the projects which are nothing short of amazing. With delivering thousands of prosperous projects delivered around the world, we have a belief in providing life to our clients’ brands by utilizing our capabilities, experience, and passion.   At LogoChemist, we provide powerful and effective branding solutions that tend to effortlessly communicate the meaning as well as the identity of our clients. Our experience related to meaning the opinions of the stakeholders and synchronizing the process of production means that we have the capability of turning the creative ideas into reality with a minimum of fuss. You need to make your first impression the lasting one!   Our Developers provide the best Website Design and Website Development services while our graphic designers provide the best logo design services. Also, we provide marketing services like SEO, SMM
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • iTester Inc

    iTester Inccertified-flagverified-flag

    5
    (1 review)
    Recommended
     
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • PCS ProStaff Inc

    PCS ProStaff Inccertified-flagverified-flag

    3.7
    (1 review)

    Business Solutions: Staffing, Payroll, HR, Recruitment, Training - PCS Prostaff

    Recommended
     PCS ProStaff Inc Providing Best Riverside County HR, Payroll services Ca, Staffing Agencies, HR, Human Resources Consultant California, Executive Recruitment, ADMINISTRATIVE SERVICES, Advisory Services in California. Trusted Business & Human Resources Consultants. https://www.pcsprostaff.com https://pcsprostaff.com/executive-recruitment/ https://pcsprostaff.com/services/staffing-services/ https://pcsprostaff.com/hr-support-center-hr-on-demand/ https://pcsprostaff.com/riverside-county-staffing-payroll-recruitment-hr-consulting-near-me/ https://pcsprostaff.com/services/payroll-services/ https://pcsprostaff.com/services/administrative-services-outsourcing/ https://pcsprostaff.com/services/business-consulting-california/ https://pcsprostaff.com/hr-consulting-executive-recruitment/
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Edbrig

    Edbrigcertified-flagverified-flag

    5
    (1 review)
    Recommended
    We are an independent branding and advertising agency , who helps brands to stand out with the help of our branding and advertising services. Edbrig is one of the fastest-growing branding agencies in Asia and the United States . In a world of chaos, we bring simplicity and creativity together by our intuitive and data-driven approach, our goal to make real brands! We are Strategic Branding and Advertising Agency. We help brands to grow and spread their wings. We love to brand your startup, luxury brand, real estate brand, or law firm .
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Hidden Brains InfoTech

    Hidden Brains InfoTechcertified-flagverified-flag

    5
    (1 review)

    Custom Software Development & IT Consulting Company

    Recommended
    Award-winner
    Hidden Brains InfoTech is a globally acclaimed CMMI Level-3 & ISO 27001 Certified custom software development and IT consulting firm that specializes in enabling digital transformation. Our company was founded in 2003 and has since achieved unprecedented growth, serving over 2400 clients in 107 countries. We have earned the distinction of being a 'Great Place to Work® Certified' organization, which highlights our commitment to maintaining an exceptional work culture and transparent business practices. Headquartered in India, with offices in the USA, UK, Norway and Africa, we bring industry expertise, unparalleled insights, global reach, and technical capabilities to unlock value across your enterprise. The Hidden Brains Edge 20+ Years of Developing Technology Solutions 700+ Agile-Enabled Professionals 1000+ Mobile Applications 4000+ Web Apps 6000+ Projects 15+ Awards 39+ Industries Services: Hire Dedicated Developers Web Application Development Mobile Application Development UX/UI Design Services Front End Development Product Prototyping Microsoft Development Cloud and DevOps Customized Solutions: Warehouse Management Smart Estate Smart Gas Station SOS App Development Vehicle Tracking Visitor Management System Time and Attendance System Telemedicine Applications Virtual Classroom Solution Multi-Vendor Marketplace Instant Messaging App Project Collaboration Tool
    No work in Innovation
    Active in the United States
    From €25000 for Innovation
  • wdmarketingdigital

    wdmarketingdigitalverified-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    No work in Innovation
    Active in the United States
    From €400 for Innovation
  • Tech Communication LLc

    Tech Communication LLccertified-flagverified-flag

    5
    (1 review)

    Digital Marketing Agency

    Recommended
    We are giving some services like web development, Seo, Social media marmarketingWordPress,ketingm mobile applications, wordpress development etc
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Intetics Inc.

    Intetics Inc.verified-flag

    5
    (1 review)

    Where Software Concepts Come Alive™

    Award-winner
    Intetics Inc. is a leading American technology company providing custom software application development, distributed professional teams creation, software product quality assessment, and “all-things-digital” solutions built with SMAC, RPA, AI/ML, IoT, blockchain, and GIS/UAV/LBS technologies. Based on proprietary pioneering business models of Offshore Dedicated Team® and Remote In-Sourcing®, an advanced Technical Debt Reduction Platform (TETRA™) and measurable SLAs for software engineering, Intetics helps innovative organizations capitalize on global talent with our in-depth engineering expertise based on our Predictive Software Engineering framework. Intetics core strength lays in design of software products in conditions of incomplete specifications. We have extensive industry expertise in Education, Healthcare, Logistics, Life Sciences, Finance, Insurance, Communications, and custom ERP, CRM, Intelligent Automation and Geospatial solutions. Our advanced software engineering background and outstanding quality management platform, along with an unparalleled methodology for talent acquisition, team building and talent retention, guarantee that our clients receive exceptional results for their projects. At Intetics, our outcomes do not just meet clients expectations, they have been exceeding them for a quarter of a century. Intetics operates from multiple offices in the USA, Europe and Latin America, hiring the best talent available worldwide. Intetics is ISO 9001 (quality) and ISO 27001 (security) certified and a Microsoft Gold, Amazon, and UiPath Silver partner. The company’s innovation and growth achievements are reflected in winning prestigious titles and awards, including Inc5000, Software 500, CRN 100, American Business, Deloitte Fast 50, European IT Excellence, Best European BPO, Stevie People’s Choice, Clutch and ACQ5 Awards, IAOP Global Outsourcing 100 and Fortune Innovative 300 lists. You can find more information at https://intetics.com
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Flash Loan BNB

    Flash Loan BNBcertified-flagverified-flag

    5
    (1 review)

    Crypto altcoins fun shibainvestor

    Recommended
    🔮Learn how to develop and execute your very own flash loan script for earning Binance Smart Chain BNB profits! Easy to perform and no download required! 👉👉 Smart Contract File for Remix: https://ghostbin.com/GZETZ/raw 👉👉Access Remix: https://remix.ethereum.org/ 👉👉Install MetaMask: https://metamask.io/download.html 👉👉Connect MetaMask to Binance Smart Chain: https://academy.binance.com/en/articles/connecting-metamask-to-binance-smart-chain The contract will create a new token and then initiate a flash loan to trade against the token. Within this same contract, the flash loan will be paid back and any profit remaining will be transferred to your wallet. This is called a flash loan arbitrage as it's looking for crypto arbitrage opportunities with the bnb coin. To get started, you need to have MetaMask browser extension installed. https://metamask.io or google 'metamask' to ensure you land on the official site. IF YOU HAVE METAMASK, SKIP TO 2:00 FOR CONTRACT FULL INSTRUCTIONS 1. Download and setup the metamask browser wallet if you don't have it. 2. Make sure you have enough BNB to pay for the token creation and flash loan contract gas fees a. The amount of BNB you want depends on how much of a loan you pull. It has to be a minimum of 0.15 for the contract to process fast enough. The higher the liquidity, the higher the profit. 3. Open remix.ethereum.org in your browser 4. Click on contract folder on the left and click New File 5. Name the file something like flashloan.sol 6. Copy and paste the contract code into the new file 7. Select the second tab on the left 8. Choose the compiler that matches the top of the code 9. Click on compile at the bottom 10. Once it is finished, go to the third tab on the left 11. Under environment, click on injected web3. This will connect to your metamask wallet so that you can interact. 12. Click on the arrow under deploy. 13. Enter the details for your new token. For the loan amount choose anything from 1000 and up. This needs to be in line with whatever liquidity you decide to deposit so it's usually .15 per 1000 bnb borrowed. 14. Click transact and then confirm the gas fees to launch the token in metamask. 15. Under deployed contracts, copy the new token contract code. 16. Go to your metamask or any wallet and send the liquidity to the new contract code. 17. Wait until the transaction is confirmed on the blockchain 18. Once that is finished, click the arrow and click the red Action button and confirm the gas fees to execute the flash loan attack. 19. That's it! The flash loan will be paid back automatically and any profit will be returned to your wallet in a few seconds/minutes. 🧠
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Addepto

    Addeptoverified-flag

    5
    (1 review)

    Driving changes through AI & Data solutions

    Recommended
    Award-winner
    Addepto is a leading AI consulting company, recognized by Forbes, Deloitte and Financial Times, for delivering cutting-edge AI and Data-driven solutions. We specialize in accelerating process automation and optimization within global enterprises using modern technologies. With a team of AI and Data experts, we are committed to creating customized solutions that convert data into real value for our clients. What makes us stand out is: Niche Industry Expertise Fast and Agile Approach Result and Goal Oriented Technological Innovation Customized Solutions Tailored to Your Needs
    No work in Innovation
    Active in the United States
    From €10000 for Innovation
  • Storm Brain

    Storm Braincertified-flagverified-flag

    5
    (1 review)

    Smarter Digital — Smarter Marketing | Smarter Web Asset | Smarter Branding

    Recommended
    Storm Brain is a leading full-service digital agency specializing in the development and implementation of digital marketing campaigns, brand strategy, UI/UX design, web, and ecommerce development. Our award-winning team finds unique ways to grab attention, communicate your brand, demonstrate why you’re important, create maximum conversions, and drive business growth and profitability. Specifically, we help businesses redefine and differentiate themselves with brand strategy and creative design, and then drive growth through ambitious online marketing and advertising campaigns. Brand Strategy | Website Solutions | Digital Marketing Campaigns What Sets Us Apart? Award-Winning work Long-standing client relationships with an exceptional reputation A multi-disciplinary team that implements transformative strategies for innovative clients. Campaigns that are specialized to your business and growth goals We act as a true extension of your team Technical expertise paired with exceptional creative
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Paper Tiger

    Paper Tigerverified-flag

    (0 review)

    We create badass websites for ambitious brands.

    Award-winner
    It's time for a website refresh and a rebrand. With so much to say, where do you start? You could throw a rock and hit a mediocre creative agency—just make sure to throw it hard. At Paper Tiger, we recommend starting with the "Why" and working backward. Why are we undertaking this project, and what's the most crucial outcome? Are we aiming for a return on investment through visitor conversion? Do we want to improve our positioning among competitors? Or perhaps it's a short-term goal, like looking sharp for an upcoming event or rolling out a new product. There are very few wrong reasons. Yes, we offer the services you're considering—branding, design, digital strategy, and most legal forms of development. No, we aren't cheap, but that's because we're exceptional at what we do. We've been at it for 15 years and counting. So let's start with the "Why" and get to know each other. We're here to demystify this process for you and ensure we have fun working together.
    1 work in Innovation
    Active in the United States
    From €3000 for Innovation
  • Kaalo LLC

    Kaalo LLCcertified-flagverified-flag

    (0 review)

    Design & Technology Company

    Kaalo is a full-service innovation, design and technology company head quartered in Austin, Texas. Kaalo serves organizations with design expertise, innovative strategies, and technology solutions. Kaalo has a global team of industrial designers, software designers, mechanical engineers, strategists, software developers, and media content creators. They have served some of the finest in the industry including Dell, HP, Ferno Washington, and Forbes Technosys developing everything from smart self-service kiosks and game changing EMS (Emergency Medical Services) solutions, to Augmented Reality tech support and AI based Digital Transformational tools. Kaalo was founded in 1993 and over the past 30 years they have served clients representing a spectrum of industries. Industry examples include enterprise level computers and servers, medical equipment, self-service machines, sports equipment, luggage, automobile, housewares, appliances, and many others. In addition to funding technology projects that benefit businesses, Kaalo also funds research and development. Some of Kaalo's most popular tech solutions include the Dell AR Assistant (award-winning tech support tool), Charm (the world’s first AR messaging tool), Opus (Books come alive), Karma (Next Gen product User Manuals), EMPWR (Tech aid for the visually impaired) and Studio (Design and technology sandbox). In 2023, the company strives to launch a line of products designed and developed by them, like wearables such as AR glasses. As a leader in the design and technology industry, Kaalo is also building a 5-acre work/play/live sandbox to open in spring 2024 in Austin. Additionally, Kaalo has offices located in Chennai, Ahmedabad, and Mumbai in India. With SOC2 certification and enterprise-level security protocols, Kaalo is a company that clients trust with their confidential projects. Kaalo is committed to exceeding client expectations and delivering high-quality deliverables on time, consistently, year after year.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • VSA Partners

    VSA Partnerscertified-flagverified-flag

    (0 review)

    VSA’s purpose is to design for a better human experience.

    VSA’s purpose is to design for a better human experience. As a strategy and design agency, we blend consumer insights and data with human-centered design to activate meaningful, motivating and measurable experiences in an increasingly noisy world. With offices in Chicago, New York and San Francisco, VSA offers a full range of fully integrated capabilities—branding, advertising, data science and technology—all under one roof. VSA is also a proud member of Meet The People, an international family of unified and independent agencies. For more than 40 years, we have delivered solutions for business and creative leaders at some of the world’s most respected brands and forward-thinking organizations, including Google, Nike, Intuitive Surgical and IBM. https://vsapartners.com/
    1 work in Innovation
    Active in the United States
    From €1 for Innovation
  • DigiTrends

    DigiTrendscertified-flagverified-flag

    (0 review)
    In 2010, DigiTrends debuted itself as a versatile digital agency with a mission of digitizing a range of sectors, including pharma, banking, e-commerce, retail, and others. It immediately emerged as a pioneering digital outfit, offering diverse marketing solutions and digital services. Our expertise in digitization has enabled us to transform many leading businesses, revolutionizing the tech industry in the process. Our success earned us wide-spectrum popularity and inspired us to broaden the horizon of our industrial expertise and global reach; DigiTrends emerged as a full-stack digital outfit. With our perfect aggregate of comprehensive digital strategies, effective communication, and tactical execution DigiTrends is now a world-leading IT firm with a full range of software development services and consultancy with a futuristic vision; DigiTrends resolves to empower its clients with robust digital services and expert marketing solutions.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Marvelworx Business Solutions

    Marvelworx Business Solutionsverified-flag

    5
    (1 review)

    Where Imagination Meets Innovation

    Recommended
    Our creative agency is dedicated to transforming ideas into impactful realities. We excel in providing innovative and unique solutions that captivate audiences, inspire action, and elevate brands. With a talented team of professionals, we push boundaries and think outside the box to deliver exceptional creative experiences. By blending design, storytelling, and technology, we create compelling visual identities, engaging marketing campaigns, immersive digital experiences, and memorable brand communications. We collaborate closely with clients to understand their objectives and target audiences, crafting tailor-made solutions that reflect their vision. Our agency fosters a culture of curiosity, collaboration, and constant innovation. We embrace challenges and solve complex problems with ingenious solutions. Our commitment to excellence, attention to detail, and timely project delivery make us a trusted partner in helping businesses and brands thrive. How Together, we will unlock the full potential of your brand, leaving a lasting impact on your audience and setting new benchmarks for creativity and success.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Umbra 3D Studio

    Umbra 3D Studiocertified-flagverified-flag

    (0 review)

    We connect real estate with is clients

    We are an architectural visualization studio that offers technological and innovative solutions for the real estate sector.
    1 work in Innovation
    Active in the United States
    From €1000 for Innovation
  • Global Synthetic Ice

    Global Synthetic Icecertified-flagverified-flag

    5
    (1 review)

    Global Synthetic Ice provides the highest quality synthetic ice rinks for small and large events

    Global Synthetic Ice is at the forefront of delivering top-tier synthetic ice rinks suitable for events of any magnitude – be it intimate gatherings or large-scale celebrations, indoors or outdoors, for brief stints or extended durations. Proudly trusted by prestigious names, including Disney's facilities and renowned theaters, our rinks have been the centerpiece of both private soirees and grand corporate galas. With a solid track record spanning 25 years, we promise impeccable, smooth-gliding rinks that guarantee the success of every ice-centric event or showcase. We invite you to reach out to us for further details.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation
  • ProfSquad

    ProfSquadcertified-flagverified-flag

    5
    (1 review)

    Precision in Quality, Excellence in Assurance

    ProfSquad cares about your goals and your customers. We analyze your business goals and priorities, help you get a better product, help your client get flawless user experience, improve your company's image. Our main goal is to eliminate issues affecting the business and reduce post-production costs. We set up, optimize, and scale the Quality Assurance process to deliver dream-team outcomes, without the hassles of hiring. We add value to your product reputation. ★ Adding QA to the in-house Dev Team Do you plan to launch an MVP soon? Do you need to test before the demo? Do you need end-to-end testing? We find the best QA fit for you. ★ Allocating QA Resources to Strengthen the Existing Team We add and onboard QA people to your team. You don't spend time on hiring. You're growing quickly and an additional QA person is what you need. It's on us. ★ Creating Test Plans and Strategies Having a clear testing strategy and a focused plan is critically important to track progress toward goals. Our QA Leads are ready to help. ★ Preparing Documentation Testing without documentation makes it difficult to see the complete picture of the project. Test cases, checklists, and knowledge base is what you need to start with.
    No work in Innovation
    Active in the United States
    From €5000 for Innovation
  • We are  Digital Scientists:  an integrated team of product designers and software developers using the latest frameworks and tools to deliver awesome new software products. We partner with forward-thinking businesses to create mobile apps, website, ecommerce stores and internet of things (IoT) applications. We believe in taking a "design thinking" approach to solving complex problems for users.
    No work in Innovation
    Active in the United States
    From €1000 for Innovation

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Keep your design innovation task in The United States closely under control!

Sortlist helps you find the best agency in United States

Looking for a collaborator in the area of The United States for your next marketing task? Do not lose lots of hours and reach out to us. Since logistics innovation agencies will be an enormous help for your concept creation or your product improvement tasks.

Why work with a logistics innovation agency in The United States?

For both limited and sizable companies is developing a new accord with a associate not at any time uncomplicated. So it is of foremost importance to find the most skilled collaborator, and we can aid your company with this step! Even the small firms that don't have the finances will, with our team, have the means to meet the fitting bureau for their unborn collaborations.

Which operations will a logistics innovation agency develop?

The services put forward by logistics innovation agencies can be, for instance, concept creation or product improvement. But even if you're looking for a bureau that will be able to aid your company with a more effortful assignment we will manage to be of help. The argument for this is that we can contact a flood of companies which collaborate with companies that work in the accounting- or even the household products sector, that makes them hugely flexible to any kind of tasks.

We guess it is safe to say that opening an activity in concept creation or in product improvement alone can easily turn into a time-consuming and pricey flop if your firm does not implement it well. Don’t overthink it and sign up a company in The United States to guarantee your success!

It is certain, identifying the most skilled logistics innovation agency is difficult. Our platform is for you hence a solid fortuity to spot the optimal bureau in The United States. Contact Sortlist and we will do every little thing that we can to smoke out the ideal bureau specialised in design innovation for you.

Are there specialised logistics innovation agencies in The United States?

our team's target is to write out a list of the 5 ideal logistics innovation agencies for your task. And they will therefore, thanks to their capacity and expertness, build benefits for your project in product improvement or concept creation. Thus relax, the bureaus in The United States will have every little thing closely under control.