The 10 Best Digital Marketing Agencies in the state of New York (2024)

Best Digital Marketing Agencies in the state of New York

Featured providers

  • Analog Digital Solution

    Analog Digital Solutioncertified-flagverified-flagfeatured-flag

    5
    (1 review)

    Seeding to Success. Co-Pilot in your Growth

    Award-winner
    Analog Digital Solution specializes in crafting strategic, impactful brand identities and customer experiences for startups. Offering a spectrum of services including Visual Identity Design, UI/UX Design, Brand Strategy, Rebranding, Product Positioning, Packaging Design, Product Photography, Animated Videos, Experience Center Design, and MVP Development, we are your one-stop studio, ensuring designs are not just aesthetic but also practically impactful and strategy-driven. Branding Agency for Startups
    3 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • ESCAL Consulting

    ESCAL Consultingcertified-flagverified-flagfeatured-flag

    5
    (13 reviews)

    "Build your influence"

    Recommended
    [FR] ESCAL Consulting est un cabinet conseil en stratégies d’influence et communication 360 : Audit, Image, Contenus, Relations Publics, Relations Media, Lobbying. Créé en 1999 à Paris, il offre un rayonnement international à ses clients avec des bureaux à Paris, New York et Shanghai. Nos 60 clients partagent tous l’innovation comme dénominateur commun. [EN] ESCAL Consulting is a consulting firm specialized in influence strategy and 360° communication : Message platform, Image, Content, Public Relations, Media Relations, Lobbying. Created in Paris in 1999, ESCAL offers international influence to its clients with offices in Paris, New York and Shanghai. Our 60 clients all share innovation as a common denominator. L’écosystème d’ESCAL Consulting  : MEDEF, Business France, bpifrance, Silver Valley, La French Tech, Paris Region Enterprises, Assemblée Nationale, Coface, Commission Européenne, Ministère de l'Economie, des Finances, Ministère de la Santé REFERENCES ➼ Big Data / AI / Tech Rh / Transformation Digitale : Payfit, Eurogroup Consulting, Golden Bees, Prevision, Stedy, Troops, CodinGame, Quantmetry, Datategy, Apidata, Alten ➼ High-Tech & Objets Connectés : Matooma, bluenove, ELA Innovation, Pixmind, AVNET, Vivoka, EURO INFORMATION TELECOM, TELEHOUSE, SENSING LABS, Pradeo, Alliance Telecom, FILENET, IoTerop, ➼ Santé  : Medadom, Fontalvie, FuturÂge, R-Pur, Oniris, La Sèche, Nutrisens, Chèque Santé, NextPharma, Concilio, Santech, Diabnext ➼ Silver Economie  : Doro, Independance Royale, Silver Valley, Papyhappy, Assystel, Villa Médicis, Bluelinea, Saveur et Vie ➼ E-Commerce / Grande Consommation et Retail : Bazaarvoice, Kelkoo, JVWEB, Mirakl , Agriconomie.com, Marques Avenue, Spartoo.com, Barndalley.com, Kang.fr, Troc.fr, Florajet, SoCloz, Oxatis, WeWard ➼ Tourisme et Transport  : Avis Budget Group, NAVYA, Agence you Airport, Eurecab, Lastminute.com, Marco Vasco, Tourism Malaysia, Maison au Portugal, France Thalasso, Vacances Bleues, SERAIR ➼ Lifestyle, Art et Culture  : Kazoart, Catawiki, Cartier, Plussh, Expertissim, Cadeaux.com, Château du Clos-Lucé, Museva, Abbaye Royale de Fontevraud, L’artisan du Regard ➼ Immobilier et Proptech  : Welmo, Capifrance, Monitivia, Libertas, Netinvestissement, GEFIC, MIPIM, Valoptim ➼ Fintech, Finance et Assurances : ITN (Gfi), Lemonway, HelloAsso, Hyperassur, Easyblue, ECA Assurances Aucoffre.com, Veracash, Alven, Butler investment Managers ➼ Alimentation, Food Tech & Restauration : LaFourchette, Wineadvisor, Resto Flash, La Boite à Pizza, InnovOrder, WeCook, Truvia, Cargill ➼ Energie / Smart grid & Dev. Durable :Uniper, Groupe Muller, DAIKIN, Spie, Équilibre des Énergies, Green Cove, Comwatt, Cameo Energy, Bulane, Oze-Energies, Ecologia, Enerfip
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Nilecode

    Nilecodecertified-flagverified-flagfeatured-flag

    5
    (2 reviews)

    Product Innovation Management, Technical Consultation, Project implementation and R&D

    Recommended
    Award-winner
    Nilecode (Established in 2011) is a multi-service web solutions provider that caters to domestic, regional, and international clients. Made up of a team of ambitious youths who are in constant engagement with the latest of trends and the most advanced of technologies, the company not only offers the most adequate strategies and designs in accordance with the clients’ needs, but is also distinguished by the promptest of responses to all kinds of arising problems and/ or inquiries. Striving for innovation and motivated to produce the most creative of ideas, Nilecode  has since its inception been eager to address all the challenges that usually face companies working in the same field, which is demonstrated in its ability to build multi-lingual Systems, implement performance enhancement in small-scale projects, reach a standard of usability that overcomes common obstacles faced by internet users, and guarantee the highest levels of security in a medium where protection is of the utmost importance. Operating with a flat management system that evades work obstruction triggered by hierarchical tension and adopting an agile approach that generates a thriving professional environment, the outstanding efforts of Nilecode team members are exerted within the framework of an invigorating process that combines premium quality with boundless originality. Last but not least, Nilecode stands out amongst other companies in the way it offers first-rate services with the most affordable of prices, a strategy that has so far enabled us to maintain long-term relationships with clients who either come back for more support or who do not hesitate to recommend Nilecode to other potential clients in search of a reliable provider.               Nilecode is proud of producing more than 150.000 working man hours during the last year, and developing/ maintaining about 4.5 million lines of code.
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Superfried

    Superfriedcertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    A design studio delivering branding solutions for global folk, since 2007.

    Award-winner
    Superfried is an independent, award winning design studio. It all began in 2007 from a London bedroom. But now Superfried delivers branding strategy from sunny Manchester. Superfried designs branding solutions for domestic + international clients across multiple industries. They vary in scale from start-ups + non profits through to global brands. When required I collaborate with trusted external specialists to create bespoke teams. Experience has taught me that every project is unique. To deliver effective strategies + creative solutions, simplicity + client collaboration are key throughout the process. So I ask a lot of questions + listen. Only then, can I fully understand your problems + design appropriate solutions to solve them. In addition to global recognition for the work online + in print, Superfried has won multiple awards for graphic design, branding + typography. Superfried is also a registered member of 1% for the Planet. So, if you like what Superfried do, let me know please it’s nice to hear. But, if you are not convinced Superfried can help, don't take my word for it – check out the verified reviews. Then drop me a message with your project requirements + I will promptly reply to arrange a chat over tea or WiFi. – http://www.superfried.com
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Growth Hacker

    Growth Hackercertified-flagverified-flagfeatured-flag

    (0 review)

    Imagine. Create. Achieve

    At Growth Hacker, we're passionate about empowering brands with the tools they need to succeed online. We go beyond just web design; we offer a comprehensive suite of cutting-edge solutions, including SEO and digital marketing solutions.
    5 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • SuccessLab

    SuccessLabcertified-flagverified-flagfeatured-flag

    5
    (3 reviews)

    Let's Grow Together

    Welcome to SuccessLab, your trusted partner in digital marketing success. At SuccessLab, we are dedicated to empowering small and medium-sized businesses to thrive in the ever-evolving digital landscape. Our mission is simple yet powerful – to help businesses grow and succeed through strategic digital marketing solutions. Our values are honesty, integrity, caring for your business as it's our own and believing in personal relationships.
    3 works in Digital Strategy
    Active in New York, United States
    From €250 for Digital Strategy

Best Digital Marketing Agencies in New York

Sort by
  • Innowise

    Innowiseverified-flagfeatured-flag

    5
    (29 reviews)

    Let's develop software together!

    Award-winner
    Custom Software Development Company Innowise is a prominent software development company in the St. Petersburg, Tampa Bay area, Florida. With headquarters in Warsaw, Poland, and offices in several countries including Germany, Italy and etc. we serve clients locally and globally. With 16+ years of experience and a team of 1500+ skilled specialists, we create innovative software solutions using cutting-edge technologies. We specialize in tailored tech solutions that streamline processes and enhance customer satisfaction. Our custom software is designed to meet your unique requirements, timeline, and budget. At Innowise, we offer end-to-end software development services. From conceptualization to testing, deployment, and support, we handle the entire process. Our expertise extends to UX/UI design, IT strategy consulting, and staff augmentation, providing comprehensive solutions for your technology needs. Partnering with Innowise means gaining access to dedicated professionals who are committed to your success. With extensive industry knowledge, we deliver solutions that drive growth and innovation. Contact us today to explore how our custom software development services can propel your business in the St. Petersburg, Tampa Bay area, and beyond.
    1 work in Digital Strategy
    Active in New York, United States
    From €10000 for Digital Strategy
  • Human Digital

    Human Digitalcertified-flagverified-flagfeatured-flag

    (0 review)

    Your B2B Digital Marketing Growth Partner

    Award-winner
    Award-winning, sustainable, design agency. Want to improve your marketing, sales, and service experience? Letâs talk! We are your local agency based in Sydney Australia and Auckland New Zealand. Our global experience and focus on your results make us different from other agencies. Want the best? Come work with us!
    2 works in Digital Strategy
    Active in New York, United States
    From €5000 for Digital Strategy
  • Coinband

    Coinbandverified-flagfeatured-flag

    4.9
    (22 reviews)

    Leading Web3/Crypto Marketing Agency

    Recommended
    Award-winner
    Coinband is a leading marketing agency for Web3 & Crypto & NFT projects. Our company has the cutting-edge client-side expertise to create better solutions for our client's marketing challenges.  By cooperating with Coinband, you get access to the best financial and crypto media and influencers. Add to that best practices in content management and the web3 community and you have a complete marketing solution.
    5 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Bird Marketing

    Bird Marketingverified-flagfeatured-flag

    5
    (10 reviews)

    Digital Mastery, Delivered by Bird 🏆

    Recommended
    Award-winner
    Bird, a globally acclaimed, multi-award-winning digital marketing agency, with prestigious offices in London, New York, and Dubai. Renowned for our exceptional expertise in the realms of Digital Marketing , we specialize in delivering cutting-edge web design , search engine optimization (SEO) , pay-per-click (PPC) advertising, and social media management . Services Web Design: Crafting bespoke, visually stunning, and user-friendly websites that resonate with your brand's identity. SEO: Implementing cutting-edge strategies to boost your online visibility, drive traffic, and ensure long-term growth. Digital Marketing: A comprehensive suite of services including PPC, Social Media Marketing, and Email Campaigns, tailored to maximize your digital impact. E-Commerce Solutions: Integrating innovative technologies to create seamless, high-converting online stores. Branding & Creative Services: Building unique brand identities that stand out in today’s competitive market. Why Choose Bird Marketing? Award-Winning Excellence: Recognized globally for our innovative solutions and results-driven approach. Expert Team: A blend of seasoned professionals from various corners of the globe, bringing diverse insights and skills. Proven Results: A track record of elevating businesses to new heights with our tailored strategies. Bird Marketing: Your Partner for Digital Excellence Connect with us to explore how we can elevate your digital presence and drive your business forward.
    14 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • www.EvolveDigitas.com

    www.EvolveDigitas.comcertified-flagverified-flagfeatured-flag

    4.8
    (7 reviews)

    Winning Together !

    Recommended
    Award-winner
    Evolve Digitas Pte Ltd is a full service digital Tech Company helping businesses scale by leveraging digital technology. We specialize in comprehending, creating and conducting digital campaigns across the web, mobile and social media platforms with a belief that creativity and imaginative thinking blended with innovative working methodology and embedding teamed and brilliant execution results in high quality advertising with standards difficult to rise up to. We conceive, design and manage high quality web and mobile applications for businesses but also drive as a technologically innovative company in the context of everyday evolving digital space. We strive forward with a passion for excellence and the belief of extensive knowledge with a touch of relevance and optimum strategy drives a team with a perfect synergistic mix of creative ingenuity and technological innovation in a rapidly changing world where technology drives everything. With focus that is always long term to foster the goal of transforming relationships with clients and consumers, we design strategies that address critical challenges for brands for effective management solutions. With a team composition of marketing, creative, technology, designing, planning and operations experts, we create a culture of cross functional and multi-platform driven work mechanism.
    13 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • JIKOODigital

    JIKOODigitalverified-flagfeatured-flag

    4.7
    (5 reviews)

    OUR TEAM, YOUR WORKFORCE!

    Recommended
    Award-winner
    WE’RE JIKOO DIGITAL THE ONE STOP SHOP DIGITAL MARKETING SUPPORT AGENCY. We are a full-service digital marketing agency with a multidisciplinary workforce, delivering high-quality digital marketing support solutions.to corporations like yours. With several years of individual experience and 5 years of relevant digital marketing agency experience, we master the entire Digital Marketing Process and answer to your needs at whatever stage you are. You can enjoy a seamless transition and workflow from one Digital Marketing Process to another while minimizing cost and maximizing ROI. The Digital Marketing Cycle has never been this simplified! Our professional and valiant Workforce is ever ready to descend on your project. Excellence is our Core Value because we are programmed to deliver! Get started with Jikoo today! Businesses thrive when they focus on their core thing. Let’s help your business do some off loading. Our Workforce is just a call away!
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • ArtX Pro

    ArtX Procertified-flagverified-flag

    5
    (5 reviews)

    To The Sky

    Recommended
    Award-winner
    We’re ArtX Pro. We provides Promotional and production service to brand or business. We’ve made hundreds of promotion video and multimedia campaign with client’s satisfaction. We love to do our work and delight business relation. We’re a small company with big agency experience, which means we make worldwide video and multimedia campaign. We have expertise to create unique concept and covert to final productivity. Our aim to produce great story about your product, that’s easy to understand and connects emotionally with customer. ArtX Pro fully equipped production and team cultivated through years of experience working on advertise, television Commercial, Event videos, corporate videos, web video, CG animation, post production and more. If you are looking to our service, that helps to promote your business and gets your customers to takes action, let’s work together.   Our Team ArtX Pro operates as a medium and mobile crew, where appropriate we invite collaboration with other individual professionals to provide extra expertise. We work with some of the most talented visualizer, content writer, website developer, UX or UI designer, director, designers, artist animators, editor and others. That helped them to generate perfect productivity.
    3 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • HUEMOR

    HUEMORverified-flag

    5
    (1 review)

    Make It Memorable

    Award-winner
    Hey, we're Huemor and our work's no joke. We help businesses like yours earn more customers, differentiate from competitors, and recruit top talent with their websites. We keep our process simple, transparent, and customer-focused. We avoid buzzwords and bullshit – we spend our energy instead focused on creating best-in-class user experiences that translate into the things that matter.
    14 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • MK+2

    MK+2verified-flag

    4.9
    (10 reviews)

    The Branding Membership®

    Recommended
    Award-winner
    We partner with founders to develop industry-leading brands. We offer a premium creative service that will help you accelerate your growth. As a branding agency, we offer comprehensive services to help businesses develop a strong and compelling brand identity. We understand the importance of branding in establishing a company's reputation and differentiating it from competitors. Our services include brand strategy development, logo design, brand messaging, brand guidelines, brand identity systems, brand research, and brand audits. We work closely with businesses to develop unique and memorable brand identities that resonate with their target audience. Our brand strategy development services involve collaborating with businesses to create a comprehensive strategy that outlines their brand's vision, mission, values, and goals. This strategy provides a roadmap for how the brand should be developed and communicated to customers. Logo design is a critical element of branding, and we work with businesses to develop instantly recognizable logos that communicate the brand's personality and values. We also help businesses develop compelling brand messaging that communicates their unique selling proposition and resonates with their target audience. Our brand guidelines ensure consistency in all brand assets, including typography, color palette, tone of voice, and brand personality. We develop comprehensive brand identity systems that ensure all brand assets are consistent and cohesive. Our brand research and brand audits help businesses understand how their brand is perceived by customers and identify areas for improvement. In conclusion, our branding agency offers a range of essential services to help businesses develop and enhance their brand identity. We are committed to helping businesses differentiate themselves from competitors, build customer loyalty, and establish a strong reputation in their industry.
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • DigiCom

    DigiComverified-flag

    5
    (3 reviews)

    We’re a No Bullshit Growth Agency, Here to Help You Grow!

    DigiCom is an NYC-based boutique digital marketing agency that’s devoted to helping growing companies surpass their goals. We don’t stop at “good enough” – we go above and beyond to make sure you get what you need to grow a successful business. We act as both a high-touch partner and marketing consultancy, providing growth programs for an impressive list of e-commerce brands and advising across all aspects of our client's customer acquisition strategy.
    6 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Ladder.io

    Ladder.iocertified-flagverified-flag

    (0 review)
    ABOUT LADDER Ladder is a growth marketing agency that uses proprietary technology and data-driven strategy to increase your ROI. Our team has spent millions of dollars and thousands of hours working with over 100 companies in New York and London. Stop guessing and start growing >> https://ladder.io/ DON'T GUESS, GROW Marketers will try what they think worked before or what they heard worked elsewhere. They either get lucky, or they get it wrong. At Ladder, we make our own luck: - 35% avg. success rate vs. 10% industry avg. - $1,000,000’s in performance data - World’s largest tactic database - Transparency into why tests succeed (or fail) We're a one-stop shop for growing your business across all marketing channels and funnel stages. Our lean, agile methodology helps us maximize growth for the minimum possible resource. We execute a set number of tests each week and use the results to determine our strategy for what tactics to bet on next. You'll work with a world-class growth strategist, armed with the Ladder Planner and our in-house creative team, to quickly iterate across the platforms, audiences, messaging, creative and user journeys most likely to work for you. Interested? Visit us online at https://ladder.io/
    8 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Craft & Root

    Craft & Rootverified-flag

    5
    (3 reviews)
    Recommended
    We are an  award-winning branding studio and digital agency located in New York and Tel Aviv. We offer our clients a range of services including: branding, website design, logo design, motion graphics, illustration, copywriting and more. 
    5 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • MVWEBSOLUTION

    MVWEBSOLUTIONverified-flag

    4.9
    (6 reviews)

    We Understand Your Needs

    Recommended
    Award-winner
    MV Web Solution is an innovative Internet marketing solutions company that offers comprehensive web development, SMO services, SEO strategies, and various other types of Internet marketing-related services. We help our customers better manage their web presence in order to achieve greater success online. In the simplest of terms, our campaigns are designed to deliver real and measurable results. We stand by your side to provide growth and productivity by busing high-class digital marketing solutions. Our vision is to provide a first-class, tailored, effective strategy, and solution. MVWEBSOLUTION is well-known for our best approach towards providing superior satisfaction to every customer. Contact More:  Mvwebsolution,LLC Email: marketing@mvwebsolution.com Phone: +1(516) 331-4131 Whatsapp: +1 (936) 536-5224 Skype: mvwebsolution WeChat: mvwebsolution www.mvwebsolution.com
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Recommended
    Award-winner
    Die Serviceplan Group ist die größte inhabergeführte, partnergeführte und am breitesten aufgestellte Agenturgruppe Europas. Im Jahr 1970 als klassische Werbeagentur gegründet, vereint die Serviceplan Group seit jeher alle Kommunikationdisziplinen unter einem Dach: ​Ob Markenstrateg:innen, Kreative, Experience-Designer:innen, Marketingtechnologie-Expert:innen, CRM-Expert:innen, Data Scientists, Marktforscher:innen, PR-Berater:innen oder Sales-Profis bei der Serviceplan Group ziehen alle an einem Strang, im House of Communication, dem einzigen komplett integriert aufgestellten Agenturmodell in Deutschland. Das präzise Zusammenspiel der Vielzahl von Spezialagenturen in Sachen Strategy & Consulting, Creative & Content, Platform & Technology sowie Media & Data macht die Serviceplan Group zur führenden Agenturgruppe für innovative Kommunikation.​ Was uns alle verbindet, ist die Leidenschaft, faszinierende Marken aufzubauen und zu coachen. Marken, die wirtschaftlich erfolgreich sind und Emotionen im Kopf der Verbraucher:innen auslösen — BEST BRANDS eben.​ Der Weg dorthin führt über innovative Kommunikation. ​ Das bedeutet, neue Wege ins Herz der Verbraucher:innen zu finden: kreativ, medial & technologisch. ​Diesen Anspruch, Marken zu BEST BRANDS zu machen, leben wir täglich im House of Communication.
    7 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • DTE Studio

    DTE Studiocertified-flagverified-flag

    (0 review)
    Award-winner
    DTE Studio is a New York based boutique creative studio and branding consultancy working with clients in fashion, luxury, lifestyle and tech. Started in 2008 by Creative Director Melissa Jones, DTE partners closely with brands to create exceptionally beautiful, tailor-made solutions across advertising, branding, packaging, experiential and digital platforms to drive premium user experiences. In 2016, DTE launched a new photo studio and media lab to provide brands an agile and scalable solution for collaborating on e-commerce, editorial, video, and web content. Specialties : Branding, Creative Design, Advertising, CMS Development, Digital, Ecommerce, Strategy, and Video + Motion
    6 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Sightsol

    Sightsolverified-flag

    5
    (5 reviews)

    Grow Your Business With Digital Marketing and Software Development

    Recommended
    SightSol aims is to provide best-in-class complete software development solutions. we provide tailored end to end App development , Digital Marketing services, Search Engine Optimization(SEO) and Graphic Design for your unique needs and preferences.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Anax Marketing

    Anax Marketingcertified-flagverified-flag

    5
    (3 reviews)
    Award-winner
    Welcome to Anax Marketing! Are you looking for an amazing digital marketing agency to work with? Well that’s great, because that’s just what we are! Anax Marketing, Inc. was founded by digital marketing veteran Michael Frost in March of 2077 to assist companies with their with digital marketing strategies. We work with companies of all sizes, from Fortune 500 companies, to start-ups, and even local businesses. We believe we can deliver significant value to any company that is looking to advertise more effectively online. Our philosophy in a nutshell is: We can help ANY company advertise more effectively online to grow traffic and sales. And that’s exactly what we do. There are many channels we can potentially work together on depending on your needs as a company. We typically look to implement and execute a return-on-investment focused marketing strategy to grow revenue and sales across multiple online marketing channels. Some of the agency services we offer our clients are: – Affiliate Marketing Programs  – Customer Referral Programs  – Search Engine Marketing (SEO)  – Increasing the website’s overall conversion rate  – Google Adwords and Bing Ads Management  – Local Search Marketing  – Social Network Page Management  – Facebook Advertising Strategy  – Twitter Advertising Strategy  – B-to-B Marketing Strategy  – Email Marketing  – Data Management and Monetization  – Customer Retention and Customer Loyalty Strategies  – Digital Marketing Consulting  – Social Media Consulting  – Ecommerce Revenue Growth Consulting  – Online Advertising Platform Auditing Since the digital marketing landscape is so diversified, we typically implement a custom strategy for our clients based on their needs after discussing what the current strategy is and what the goals of the client are. This could be one service or several services going on simultaneously. For some companies we are their entire online Marketing Department. For some, we are an outsourced service provider. And for yet others, we are their trusted consultant; their ace in the hole so to speak, cutting out the learning curve so growth can be achieved more rapidly. Please let us know how we can assist your company to take you the next level.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • GOIGI

    GOIGIcertified-flagverified-flag

    5
    (5 reviews)
    Recommended
     
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Justin Jenkins Designs

    Justin Jenkins Designsverified-flag

    5
    (4 reviews)

    Branding The World. One Client at a Time.

    Recommended
    Award-winner
    A great brand is memorable and stands out. At Justin Jenkins Designs, the nucleus of my passion lies at the heart of innovation. Taking an idea and elevating it through analysis and creativity is the driving force behind my work. I want to create something that is fresh, exciting, and unique. Simple or complex, the entire idea and conception must exude a vibe and commercial appeal that separates itself from the competition. This design challenge is a creative energy that I harness into innovative visual solutions for each valued client. Elevating your ideas and vision is my number one goal.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • DBNY

    DBNYverified-flag

    5
    (2 reviews)
    DBNY is a design-thinking agency, singularly focused on building digital experiences and solutions that change the face and trajectory of brands. Assembled as a team of design, marketing, and engineering experts — we help merchants create brand-specific experiences that accelerate growth, reduce operational inefficiencies, and improve the lifetime value for their customers. With 25+ years of experience designing in the various fields of marketing & advertising, branding, product design, and engineering — we’ve spent the last five years focused specifically on eCommerce, Automated Retail, Product Design and User Experience Design.   Services Overview Strategy:   Goal Assessments, Content & Site Audit, Market & Industry Positioning,  Business Model Canvassing,  Experience Planning Design: Rapid Prototyping, Wireframing, User Flows and Purchasing Path Definition, User Experience Design, User Interface & Visual Design Technology: Front-end & Back-End Development, E-Commerce Development, 3rd Party API & Systems Integration, QA
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Fusing Marketing is a premier digital marketing agency based in Long Island City, New York. Our company was founded by Jason Ospina, the son of 2 Colombian immigrants, who started the business from scratch and built it into a thriving establishment. Our agency is backed with years of experience and we strive to remain on the cutting edge of the ever-changing digital marketing landscape.  
    4 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Amplify Bizz

    Amplify Bizzcertified-flagverified-flag

    4.6
    (1 review)

    Your digital presence just got a boost!

    Recommended
    At Amplify, we specialize in using AI to transform your existing content (audio, written, or older videos) into engaging videos for social media. We combine advanced technology with a digital agency and social media services suite to help you boost your digital presence. Whether you are a big company or a small business just starting out we have a package that works just right for you.
    3 works in Digital Strategy
    Active in New York, United States
    From €499 for Digital Strategy
  • BusySeed

    BusySeedverified-flag

    5
    (3 reviews)

    Literally #1 in Digital marketing as ranked by TrustAnalytica, Expertise and others.

    Award-winner
    For a decade, BusySeed has championed over 500 businesses, unlocking $1B in opportunities through our vast array of services. Experience unmatched results, exceptional service, and a partnership that evolves with you.
    1 work in Digital Strategy
    Active in New York, United States
    From €5000 for Digital Strategy
  • SEO Company in the USA SEO Agency is a top SEO Company in the USA. We are the best Search Engine Optimization Company for small businesses. Our SEO experts mainly focus on Google SEO Optimization. We are the best local SEO Company in New York, NY. Cool SEO Services is a good solution for promoting your business on the Internet. We can help you to manifold the number of visitors on the website. We have a transparent and flexible scheme for calculating the promotion budget, taking into account both the complexity of the request, and various target positions, types of links – ordinary, eternal, news. How many links at the moment in the index, what positions by queries, etc. In short, nothing is hidden from the client. This makes us happy. We have promoted several projects and our clients through flexibility and accuracy, high level of support and maintaining clients’ privacy. Cool SEO is an excellent SEO Company in the USA for online promotion. Operationally we carry out the modifications taking into account our clients’ wishes, and the clients are delighted with the result. Despite the high competition in your industry, with the help of Cool SEO Services, you can achieve excellent visibility in the search engines. Search  Engine Optimization (SEO)  increase s  your   visibility   in   search   engines,  through  on-page   and  off-page  optimization  techniques. We, being the best SEO Services Company in the USA, will help you improve the ranking of  your  website,  visibility ,  traffic   and  sales. As an experienced specialist in  the  field  of  Search Engine Optimization,  we accompany your internet presence with a tailor-made optimization strategy to success. First of all, get a quote now for free without obligation. With targeted  SEO,  we reach your customers. Exactly where they are looking  for  your product or service. This saves you the cost of clicking and the daily budget for Google AdWords campaigns. We even achieve  more  clicks  and  impressions  with   the  organic rankings. Our agency offers  you professional  and complete SEO solutions.  W hich can help you achieve more sustainability and  improve the ranking of your website. I mprove search engines  ranking  with our radical methods.  We  improve  your  placement permanently. We  bring  our experience  and  creativity into all SEO areas. Since  more visibility  means  more  traffic.  Make  sure  your customers  see  you – at the time when they want your product or service.  As a result, extend  your  reach with new audiences. We work  hard to  increase traffic  to your  site. All  in the  organic part  of the search engine with  no click cost.  The  benefits,  at a glance,  with  our  experts: long-term  search engine optimization .  We  create  the  basis  for  long-term success  with  targeted measures, optimal use  of online marketing  synergies, conversions code, content and design. We connect all SEO areas with tailored solutions. We develop a strategy that suits  you  exactly.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • CHR Media Group

    CHR Media Groupcertified-flagverified-flag

    (0 review)
    We are a digital media agency. We analyze our client’s data to discover behavioral and audience insights. Having access to the right information and knowledge to support every decision results in confidence. So, we share how to convert this data into action and increase your performance. We develop the strategy, buy digital media and optimize our clients’ multi-channel digital advertising campaigns. We focus on how to improve your conversion goals to drive more qualified leads and revenue. We manage all digital channels creating the ability to combine and dissect each channel to understand how one might be helping or hurting the other. We drive the right traffic and target the right audience effectively. Together, we build scalable solutions to grow your business. Review our case studies to learn how we have helped others: • Cut acquisition costs in half • Double new users • 3x qualified leads • 12x ROI   SOLUTIONS Big data is still a big mystery to many. The big secret, the data itself doesn’t really hold any value. The value is actually found between the lines of data. We know what data to track, measure and analyze to glean viable commercial insights. We convert those insights into actionable change. By understanding how to take insights and turn them into a scalable solution, this is when things become very interesting and create real tangible value for our clients. Most sales and marketing strategies cast a very wide net. This common approach leads to spending a lot of money, very ineffectively. We flip the typical approach to marketing and the common sales funnel on its head. Instead of starting very wide at the top with a broad audience, we start very small by targeting an individual, your ideal customer. We call our approach the Reverse Funnel. As we begin the campaign we immediately begin optimizing and branching out as we will constantly discover new opportunities and indicators of success. This results in a lower cost of entry to ramp up towards building a scalable solution offering predictability and confidence. We start with what you know, the data you have access to, and discover what is yet to be explored. Our team will make sure you are tracking the right data and have measurable conversion goals. We develop a strategy that focuses on driving performance for you and your business. You stay involved so you can learn and apply new methods. Together, we target the right audience, the right traffic and spend your budget more effectively. Typically, we are asked to help our clients: • Build Awareness (deliver impressions) • Drive Actions (increase customer spend, cart size, clicks) • Acquire Customers (reduce cost per lead or raise purchase transaction) • Capture Audiences (remarket or build data and analyze)
    3 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Marketing House NYC

    Marketing House NYCverified-flag

    5
    (1 review)

    360° Excellence in 8 Languages – Marketing House: Your Multilingual Marketing Partner.

    Recommended
    Marketing House, headquartered in New York and with strategic offices in Istanbul, Antalya, and Cambridge, is a dynamic powerhouse that caters to your global marketing needs. Our widespread presence, coupled with our expertise in 8 languages, enables us to deliver comprehensive 360° solutions tailored to your brand. From PR and advertising to creative works, design, and web development, our multinational team redefines success in the world of marketing.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • adCookie

    adCookieverified-flag

    (0 review)
    Award-winner
    NOT JUST A DIGITAL AGENCY BUT A PART OF YOUR DIGITAL TEAM. adCookie is a team of digital-enthusiasts who believe in the exceptional power of digital. We help brands all over the world to overcome their marketing challenges. Check our clients' reviews to make sure we do our best when it comes to satisfaction and quality. Our digital experts create complex PPC campaigns using the whole potential of Google Ads and Facebook Ads to improve your brand’s results. If you want to have a good first impression on your customers cooperate with us on your website as we build only effective and user-friendly ones. We believe there are no average results as well as average brands and are ready to prove it. Let’s talk if you share that view! OUR PHILOSOPHY:  WE LOVE BRANDS WE WORK WITH  We treat the digital challenges of our clients like our own, so we put 100% of the effort into everything we do. Perceive us as a member of your digital team, who is fully involved rather than just a digital agency. WE HAVE AN INDIVIDUAL APPROACH TO EVERY CLIENT  We adapt to the client's organization needs. Thanks to our media planning and design in-house teams we can offer various services tailored for client’s needs: strategy creation, branding, online campaign planning and execution, social media management or website creation. WE ARE COST-EFFECTIVE  Not only we have very attractive prices, but we also do our best to optimize your campaigns and spend your money wisely. WE DO NOT MASS-MANAGE CAMPAIGNS  Every campaign in adCookie is personalized according to the client’s business challenges. We make sure that our specialist takes as many campaigns as he can handle at its best. WE CODDLE OUR REGULAR CLIENTS  Once in 6 months we arrange training for clients on new trends in digital and send reports on changes in their industry and competitors’ online activities.  
    3 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Imenso Software

    Imenso Softwarecertified-flagverified-flag

    5
    (3 reviews)

    Full Stack Tech Consulting Agency

    Imenso Software is a premier solution provider, focusing its strength with right mix in Web Based Enterprise Solutions, Custom Application Development, Web Development, CMS, E-commerce Solutions, and much more to gratify with the needs of both small and large businesses.   Our mission is to offer high-quality IT services that evolve with corresponding business trends and technology.
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Beyond

    Beyondverified-flag

    (0 review)

    Beyond is a design agency helping brands make progress by improving their customer experiences.

    Award-winner
    Beyond is a design agency dedicated to helping brands make progress by improving their customer experiences. Through a mix of strategy, technology, and design thinking, their teams can create an array of CX solutions—from journey maps to websites to apps. For over a decade, Beyond has served clients as varied as Google, Montblanc, and Brompton. Beyond is part of the Next Fifteen Group, an AIM-listed company. For more information, please visit BYND.com.
    3 works in Digital Strategy
    Active in New York, United States
    No budget for Digital Strategy
  • Ink, Inc. Creative Group is a full-service marketing agency operated out of Brooklyn, NY. We specialize in matters of strategic messaging, branding, and digital marketing services for businesses that range in size from the very small to the very large. We remain focused on the intersection of strategy and creativity to drive successful client results. This holistic approach enables us to generate innovative, cross-channel solutions tailored to the unique needs of each client and their current competitive landscape. Our goal is to get your message out there in a way that speaks directly to your targeted audience, driving more conversions that will help your business grow.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Huge

    Hugecertified-flagverified-flag

    (0 review)
    Huge is a global collective of designers, strategists and technologists. We’re passionate about helping companies play trusted roles in people’s lives by creating products, services and brands that people truly love. We were the first agency to be founded on the idea that the principles of user experience should not just drive design, but business and marketing. We’re known for finding new ways to harmonize the things clients need with what users really want to create experiences that change industries. Over the last decade we have been fortunate to partner with nearly 400 of the world’s best known brands — including over 10% of the Global 500 — on their hardest and highest-stakes digital transformation initiatives. We specialize in helping clients overcome barriers to innovation and get to market quickly with the right product, campaign or initiative for their business. We have built a comprehensive and continually evolving service offering to help our clients thrive in a world in which digital interaction defines both their brands and their businesses. We work with our clients on everything from business and brand strategy to Super Bowl campaigns, personalized global omnichannel experiences, connected environments and even smart products that leverage data to anticipate user needs. We strive to partner with the world’s most ambitious brands — companies that care as much about shaping culture and defining the future as we do. Our aim is to produce breakthrough work that significantly drives our clients’ business performance and defines excellence in their respective industries. We have a ten-year history of delivering this level of innovation. We created the world’s first multi-country e-commerce platform for IKEA; the travel industry’s first digital-centric airline with JetBlue; the iPad’s first native news app for Reuters; the world’s first mass-market social campaign for Pepsi; and HBO GO, the multiplatform TV experience that redefined user expectations for entertainment. Our work has established us as one of the industry’s most prominent agencies. In 2014 were recognized as Agency of the Year by MediaPost and iMedia; we’ve been recognized as one of the leading companies driving innovation in the marketplace by Forrester Research, Digiday and Mashable; and we’ve been named in Advertising Age’s annual A-List issue five times in the last six years. As a result, Huge has grown faster than any other agency in the United States over the last four years. Headquartered in Brooklyn, we currently have more than 1,200 employees working across 12 offices in North America, Latin America, Europe and Asia Pacific. Huge operates as an independent agency within the Interpublic Group of Companies.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Endai Worldwide

    Endai Worldwideverified-flag

    (0 review)
    We have a passion for making it better, making smarter software, and Making Success. We have helped clients succeed consistently and at scale, since 1999.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • BrandBuilders.Pro is Long Island's premier Digital Marketing Agency providing a holistic suite of strategic marketing services and consultation. Our methodologies have been proven to attract larger audiences with targeted, engaging messages designed to close leads into customers. Our comprehensive services include SEO, PPC / SEM, Email Marketing, Social Media Management, CMS Web Development, E-Commerce Deployment and HTML Email Marketing with a strong emphasis on the Inbound Marketing methodology.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • L+R

    L+Rverified-flag

    (0 review)
    Award-winner
    L+R is a strategic consultancy and design and technology studio with offices in Brooklyn, Barcelona, Los Angeles and Milan. Founded in 2012, we work with clients to create real value and impact with the balance of strategy and aesthetics. Our multidisciplinary design and technology team works with individuals, organizations, and businesses on seamless digital experience projects within technology strategy, next generation mobile applications, management consulting, design, and brand systems. – Manifesto We are motivated by our desire to build products with economic, social, environmental, emotional or physical benefits. Technology has a critical role in shaping society and we are guided by a commitment to responsible innovation. – Our Pillars Integrity Empowerment Harmony – Our expertise at L+R are our specialized capabilities in: Strategic Consulting | Collaborating with business leaders to define, create, and launch inspiring initiatives. Branding | Building trust by communicating an authentic character to capture hearts and minds. Research & Usability Tests | Exploring the user journey, identifying usage issues, and creating the optimal user experience. Design | Visualizing the most powerful representation of your brand through compelling creative. Mobile Development | Redefining modern mobile applications with industry-leading design and engineering. Innovation | Let’s push things forward! – Client highlights : Louis Vuitton, Esteé Lauder, Global Citizen Festival, Schumacher, GE, Amazon, Hilton, Bond (purchased by Newell Brands), Google, Footlocker, Newell Brands (First Alert, Yankee Candle, EXPO Markers, Contigo).
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • INSPIRATIQUE

    INSPIRATIQUEverified-flag

    (0 review)
    INSPIRATIQUE is the business and marketing agency for global companies and luxury brands, We accelerate the brand and business performance and creativity in its expression with high class, all-around, progressive services in the broader territory. We do so because we believe in our trusted expertise from hands on business experiences, the in-depth understanding of human intellect, and the unique industry environment and network only we can build and leverage anywhere in the world. For brands and businesses, we aim to pour more... ​ Creativity into global business – emotion intellect, organizational skill​, understandings of cross-cultural interactions and emotions Creativity into brand marketing - high level understanding in client business, one of a kind industry network on top of the marketing services INSIGHT The greater and the more innovative the mix of creativity and marketing strategy become, it is getting harder to achieve the desired success due to :​ -the expanding definition of "marketing" ,​ -the ambiguity of the measurement results as the reflection of the overall contribution of the long –term brand value, ​ -the changing power-balance and relationships between the critical market players such as influencers, celebrities, business, platforms, media companies, internet companies, social media, brands, marketers and agencies, ​ -the new globalism and localization orders and trends, as well as new relationships between global management and constantly transforming emotions and cultures in the target markets,​ -the technology developments and more individual specialization and difference in behavior tendency due to social justification for more diversity and inclusion ​   STRENGTH Entrepreneurial-minded with creativity focused. Hands on business experiences weigh in execution and end delivery Consultation and leadership Luxury sector with focus on issues around global planning and local adaptation, business strategies, branding and innovation. Consideration of human emotions, talents, behavioral patterns, psychology, cultures, and cross-cultural interactions.  
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Award-winner
    We are a creative agency with a passion for building websites with strong UX design that help eCommerce vendors reach new heights. That’s why we love to partner with retail businesses, complete with all the unique challenges and new opportunities they offer.  From local retailers launching their first online sales channel to successful online entrepreneurs bringing their businesses to the next level, we are dedicated to creating websites to help businesses reach their highest potential. Some of our outstanding clients include but are not limited to:  - Proraso - Kulani Kinis - LXGS - Netaya - Merida - Calm - Anne Cole In today’s fast-paced digital world, you’re looking for results, and we’re looking to give you those results and beyond. We believe in digital marketing not as segments, but as a whole. With cutting edge technology and backed by a relentless team, we strive to innovate and have a positive impact. Our digital marketing platform ranges from SEO, Paid Search, Conversion Rate Optimization, Content Strategy, Emal Marketing, you name it.    We excel in web design and web development. We start each project with a personalized brand immersion session. We believe that the better our team knows your brand, the better we can provide a product that meets your business’ needs. We do this through a series of questions designed to learn all about your business model, brand image, target audiences, competition, and products.   After agreeing to a project proposal, our expert in-house development team begins building a pixel-perfect website that works seamlessly across both desktop and mobile devices.  The goal is to deliver a sleek, modern design with all the features and functionality to work as smoothly as it looks. The best part? All our websites are grounded in Shopify® best practices to ensure results.   Progress is a journey and you won’t be going it alone. We assign an experienced backend navigation trainer to work one-on-one with you to make sure you’re proficient and comfortable in all the backend admin features. They’ll stay on-call to answer any additional questions whenever you need them.  We also work with you to define your business goals, communications objectives, and KPIs (key performance indicators) so you can reach the success you are aiming for. After all, your success is our success.   We can help you tailor your Shopify® store to meet any of your needs- from automated operations processes to tiered upsells at check-out. It’s all part of the Parkfield difference. Custom development We create beautifully designed eCommerce stores that capture the essence of your brand and that is geared to sell. ERP integration Whether you’re using Netsuite, SAP cloud, or a custom in-house solution to manage your inventory, we will get your systems connected. Shopify® migration With over 50 successful migrations completed from other platforms under our belts, you can rest assured that you’re in great hands with us. We create beautifully designed eCommerce stores that capture the essence of your brand and that are geared to sell. We have found that Shopify® and Shopify Plus® couple speed and agility with the scalable foundation you need to grow your business bigger, faster. That’s why we have helped a number of clients migrate to the class-leading platform to bring their businesses up to a new standard of ease and efficiency.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • We are here to build you a customized system based on your business goals and budget. Therefore, if you are looking for your website analysis or website feasibility, Social Media Optimization (SMO), Social Media Marketing (SMM), Search Engine Optimization (SEO), Website development, Content Marketing or Search Engine Marketing (SEM) then  Digital Marketing Buffs  is here to partner with your vision.
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • RMG Media, LLC

    RMG Media, LLCcertified-flagverified-flag

    (0 review)
    Award-winner
    RMG is a full-service digital commerce agency that guides B2C and B2B retailers through digital transformations and quickly ramp up growth in their digital channels. When customers love your brand experience, they buy your products and services. They come back often and share your brand with others. Our clients trust us to help them thrive by creating solutions to identify and engage rewarding customers.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Fifty Six Advising

    Fifty Six Advisingcertified-flagverified-flag

    (0 review)

    “Not your mother's” agency

    Fifty Six is “not your mother's agency.” A global marketing & e-commerce agency with a focus on early-stage apparel and lifestyle brands in the premier retail space, clients are presented with a world where marketing is easy to understand, and growth is inevitable. Known as efficient experts in the digital industry, services include full-funnel marketing strategy and execution, e-commerce design and development, public relations services, and more. More than just an agency, Fifty Six is a multidisciplinary, fractional marketing team providing above and beyond planning, optimization, and support for all functions needed for a brand to be successful –– with a proven track record driving scalable growth for direct-to-consumer businesses to prove it. Find more information, visit www.fiftysixny.com and @fiftysixny.
    2 works in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Red Collar

    Red Collarverified-flag

    5
    (1 review)

    Multi-Webby Winner and Twice the Best Digital Agency in the World by CSS Design Awards.

    Award-winner
    Every company has its philosophy. We want to help our clients wishes came true. It is important for us to stay ahead of market’s strategies, technologies and creativity. Don’t believe? Check out the project section — that’s the place where miracles happen.
    1 work in Digital Strategy
    Active in New York, United States
    From €3000 for Digital Strategy
  • hackerspytech

    hackerspytechcertified-flagverified-flag

    5
    (2 reviews)
    Recommended
    No work in Digital Strategy
    Active in New York, United States
    From €500 for Digital Strategy
  • B-Reel

    B-Reelcertified-flagverified-flag

    (0 review)
    B-Reel is a creative agency connecting modern brands and audiences through innovation in storytelling and technology. With offices in New York, Los Angeles, Stockholm, London and Barcelona, B-Reel's clients i nclude Google, LVMH, Klarna, Storytel, American Express, Nike, and H&M. For more information, visit B-Reel.com.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Cardwell Beach

    Cardwell Beachverified-flag

    (0 review)
    Cardwell Beach is a creative agency founded by the talent behind the E*Trade Baby Campaign. Our digital initiatives fuse Madison Avenue branding with Silicon Valley technology to bridge the gap between sales & marketing, and launch companies to the next level.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • "We got tired of old 'ish' not working and decided to focus on challenging our clients with a new directive on their communications" - Romey Louangvilay, Director of Digital Marketing Curate Directive emerged after our team spent years working for large corporate communication agencies and fledgling boutiques and realized their flaw - relying on old school strategies that worked... back then.   In other words, we wanted to return to marketing's core roots within storytelling and think like art curators, but for the digital age. We review brands' heritage, audit market performance & digital/social footprints, and review industry insights to selectively choose (Curate) strategies and integrate them in your communications direction (Directive). Simply put, we aim to #CurateTheDirective. PREVIOUS & CURRENT CLIENTS INCLUDE:  Tourism Authority of Thailand, Royal Thai Consulate, Pernod Ricard's BarSmarts, La Marina, Peninsula Hotel, Guana Island, Singha Beer, LivetheLook, ISAORA, and more.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Recommended
    Our team has been online since 1993. In 1996 they founded Cydian Technologies, one of the first ICANN accredited domain registrars. This evolved into web hosting and quickly into online marketing. We've offered search marketing to our clients for over a decade.
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Ziggle Tech

    Ziggle Techcertified-flagverified-flag

    (0 review)
    Ziggle Tech is a New York-based eCommerce and Enterprise Website Design and Development agency. For retailers who are looking to replatform their eCommerce or digital web platform, we provide consulting services to choose the right platform for their business and also help them to replatform and migrate to the new platform. We believe in choosing the right tool for the job therefore we have expertise and partnership with various technologies and platform providers. We also provide scalable cloud infrastructure development service for growing businesses. We work with Shopify/Shopify Plus, Magento, Spree Commerce, AWS, GCP, WordPress, Drupal, Pantheon, Ruby on Rails and other technologies and platforms. We as a team have 100+ years of experience in designing, developing, and scaling eCommerce websites and enterprise websites/portals. Ziggle Tech is a global organization whose expertise include digital transformation consulting, cloud infrastructure development, web platform modernization, marketing automation, and digital platform engineering.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Fusion is a Strategic Design Partner. We believe in design strategy without compromise; delivering transformations that create value, bring results, and influence behavior. We provide branding, design and development services across the spectrum for digital, traditional and experiential content. We believe that great design drives business, improves lives and makes a difference.   Do you know how your customers are interacting with your brand? How they’re using your site? Are your employees achieving their best with the tools you’ve provided? How about your sales force? Are there things you could be doing to increase your conversion rates? Are you really seeing a return on your digital communications and social marketing? Companies that make an investment in strategic design are in a much better position to answer these questions and succeed in the marketplace. We’re here to help. Great Design is at the heart of all that we do; from our strategy, to our approach and our service promise. In today’s sea of constant change, well-designed solutions drive business forward and deliver results. Let’s design something great together.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Founded in 2007, Talent Resources is a digital marketing agency recognized as a leader in developing and producing influencer based social media campaigns. The Company provides holistic marketing solutions to brands and full service, social platform management to talent and businesses. The Company’s influencer model begins with proprietary social media insights, leading to the development and production of bespoke consumer experiences and story-based content produced with culturally relevant talent, stimulating consumer conversations, increasing brand awareness, and driving digital engagement.
    1 work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Increasio

    Increasiocertified-flagverified-flag

    5
    (1 review)

    Sophisticated web development agency, Next.js, React, Svelte and JS developers

    Recommended
    Jamstack development agency specialized in sophisticated, secure, scalable, and lightning fast websites and landing pages development.
    No work in Digital Strategy
    Active in New York, United States
    From €1000 for Digital Strategy
  • Design Alligators

    Design Alligatorscertified-flagverified-flag

    (0 review)

    Digital Design Agency in Brooklyn, New York, United States of America

    Design Alligators is one of the Leading Digital Design Agency in Brooklyn, New York, & has been creating stunning and Professional Website & Logo Designs for more than 5 years, with thousands of projects under our belt. We have been expertly converting dull, unappealing websites into sleek, beautiful, professional sites. With every project that passes through our doors, we gain more experience and hone our skills. Design Alligators is a branding, digital marketing, and web design agency located in New York City, USA. Our team works around the clock to develop designs that meet your web page needs.
    1 work in Digital Strategy
    Active in New York, United States
    From €50 for Digital Strategy

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Keep your digital strategy project in New York on a tight rein!

Why work with a digital marketing company in New York?

We also can mention an advantage with the popular dictum: time is money! Why waste time on an task that your business doesn't fully understand. Keep focused on your core business and do not take a chance with the creation of an activity that your enterprise doesn't master.

No more annoyance and neverending investigating for the perfect digital marketing company, Sortlist is the ideal solution. Deliver Sortlist your assignment immediately, and our team will guide your company in finding the perfect agency.

Sortlist helps you find the best agency in New York

Searching for a collaborator in the neighborhood of New York for your next communication operation? Do not lose lots of hours and call us. Since digital marketing companies will be a huge support for your digital strategy building or your linkbuilding operations.

digital marketing companies in New York.

A large inventory of services is provided by digital marketing companies, for example digital strategy building and digital strategy formations. Thus don't hold off anymore and call those firms through our site, and you will manage to commence your activity directly.

To be successful in, for example, a campaign in digital strategy formations or in digital strategy building, is cooperating with a expert company in digital strategy of capital importance. And your company surely fathoms that there is a flood of expert companies like that in the world. So keep things simple and email Sortlist.

How to make a choice?

digital marketing companies in New York have a lot of genius, so your firm can be sure that they will convey huge benefits to your task. They will have a immense positive imprint on your business. This is one more reason to collaborate with our company.



Frequently Asked Questions.


A Digital Strategy Company charges ranging between 8800$ to 10300$, according to data compiled from Sortlist involving 36 works. However, the real price might vary according to your specific needs of the project, the complexity, plus the skill offered by the agency.


Working with a Digital Strategy Agency in New York offers numerous advantages due to the city's prominent position in various aspects. Geographically, its East Coast location allows for easy access to both domestic and international markets. Culturally, NYC is a melting pot of diverse ideas and innovative trends that can inspire fresh digital strategies. Economically, the city is a hub for major industries, providing an extensive network of potential clients and collaborative opportunities. Furthermore, the local environment cultivates a competitive spirit, ensuring agencies stay up-to-date with cutting-edge digital advancements to offer top-notch services.


Digital strategy agencies, such as those specializing in Growth Marketing, focus on assisting businesses in developing and executing effective online strategies to meet their marketing and sales objectives. By evaluating a company's digital presence and target audience, these agencies identify growth opportunities and areas for enhancement. With their expertise in digital technology and Inbound Marketing techniques, they design comprehensive plans covering various digital channels, including SEO, social media, email marketing, content creation, user experience, and website design. These digital strategy agencies continuously monitor the outcomes of their digital initiatives, making data-driven modifications to optimize performance and maximize ROI. Their in-depth knowledge of the ever-changing digital landscape makes them essential for staying ahead of competitors and driving long-term business growth. For businesses seeking expert guidance in navigating the digital world, Digital Consulting services can play a vital role in achieving success.