The 10 Best Social Media Agencies in Madhya Pradesh (2024)

Best Social Media Agencies in Madhya Pradesh

Best Social Media Agencies in Madhya Pradesh

  • Good Relations

    Good Relationscertified-flagverified-flag

    (0 review)
     
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • We are not a conventional digital marketing agency. We are not an agency at all, we are the path breakers and disruptors when it comes to the whole gamut of online marketing. In today’s world where online presence is taking many organizations really far, a lot of organizations in India’s Tier 2 cities are struggling in leveraging online marketing for the betterment of their businesses. The reasons:  1.      Lack of Knowledge about the Nitty Gritties of the Digital Landscape 2.      High Cost Barrier 3.      No 360 Degree Integrated Marketing Communication Plan 4.      Agencies care less about marketing and focus more on technology We at the communication hub believe in making Online affordable for small and mid-size businesses all over again. The key services essential for effective online marketing like content writing, designing, website management and analytics, search engine optimization, social media marketing, etc. are being provided through our carefully crafted suite of packages at more than 10 times lower prices than any other company.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • We are a full service digital marketing company and our services include: paid media, SEO, conversion optimisation, analytics, social media, content marketing, influence marketing, web Development and creative services. Our team’s diverse range of skills allows us to create dynamic, holistic and salable campaigns for all of our clients.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • DV Infosoft Pvt. Ltd .  is a proficient Software development and website designing company established at Bhopal. We impart a great number of software & website development services. It includes Web Development where we provide a total package of website development to help you boost your business. Till now, we have a huge quantity of effective projects to be delivered especially for Hotel’s Software. Web Designing is one among our key features in which best designs for higher customer satisfaction is provided to assist you enhance your business. Our first priority is to give quality services to the clients all over the globe on the basis of long term relationship. Graphic Designing is done where a mixture of imaginations, creative & brilliance stylizing are achieved. Imparting splendid services in distinctive fields is our sole objective. We believe in providing unique, wonderful and superb web solutions that gives us a positive testimonial from our clients. We have a dedicated team with an excellent blend of technical, professional, functional knowledge & result oriented team. We make sure our team is experienced, trained & possess skillful knowledge. We not only provide you a field of expertise but also are good at translating technology into valuable business websites & application. Our services are affordable, versatile & possess standard quality. We have scalable & organized inventory management & ERP system. We therefore take pride in both our business competence & strong technical skills. It’s built from the ground up, using the latest web technology in which our technical experts excel. We provide following services: # Web design & development # Websites (e-commerce and business websites) # E-commerce Portal and payment gateway integration # Mobile Applications #Barcode Solutions #Customized Software Development # Social Media marketing # Search Engine Optimization (SEO) # Pay Per Click services (PPC) # Online Reputation Management (ORM) # E-mail Marketing # Content Writing #Domain and Hosting Provider #CCTV and Surveillance Services #Bulk SMS and Whats App # Content Marketing # Video Marketing #Logo and Graphics Design #Social Media Optimization(SMO)
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • The technical expertise of our young and talented professionals coupled up with modern project management tools enable us to meet client's development needs within mentioned deadline and without compromising on quality. We believe in building long term relationship by providing value to our customers through innovation, support, and confidence.   Why have us? Since our company is born, 95% of our clients have initiated repetitive business with us, alongside, we continue to grow at a satisfactory rate year-on-year just by referral business. Some of the reasons why we can retain our clients are:  Time Management: Clearly defined processes, team wise breakup of tasks, and parallel execution results in reduced development time.  Project Management: Web-based and mobile devices compatible project management tools are used to Plan, track and collaborate on projects. The same results in better communication, improved efficiency, and reduced costs.  Price: Availability of the vast pool of good technology workers at the local market and company investment in training and skills enhancement has enabled us to provide high-quality work to clients at the cost-effective price.  Experience: We have successfully served over 120 web and mobile projects from 15+ countries around the world.  Design & User Experience: We ensure an alluring and definite quality of design along with high level of User Experience for all our projects.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • INTELLARC is a versatile platform for all IT solutions. We have created a unique identity among thousands of organizations across the globe because of our performance. Our hard work, creativity, and skills make us a leading company in IT services. We are proud to collaborate with professionals IT software developers who are experts in providing services like Web Development, Mobile App Development, Software Testing, Cloud Service, Internet of Things, UI/UX Design, etc. We offer a wide range of services that has the potential to deliver valuable projects to the clients. "Creating value through turns your idea into reality". Website is the foremost part of any online business. So it has to be impressive, eye-catching and easy to understand. INTELLARC ensure the customers to render quality work at a cost-effective price. We keep profit-making aside and focus on producing quality projects. Although, we work with some conditions in which first priority is the satisfaction of the client. The only dream of our company is to make clients dream come true with our efforts.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Digital9X

    Digital9Xcertified-flagverified-flag

    (0 review)
    Digital9X, a leading SEO and PPC digital marketing agency in Bhopal. We’ll assist you with getting exceptional outcomes and produce more clients. We accept that the future of marketing is digital, and we can utilize a full scope of advanced showcasing administrations to help boost your online potential. Regardless of whether you offer to organizations or buyers, more visibility implies more leads and clients to your business. READY TO REIMAGINE YOUR BUSINESS? We help you stay ahead by optimizing digital marketing. In case you’re searching for genuine business development, SEO, or search engine optimization is the strategy for you. For what reason accomplishes it work? Straightforward! It focuses on the clients that are destined to change over on your website and takes them there.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Kiaavi Technologies, a pure-play digital marketing agency specialized in Social Media Marketing, Social Media Advertising, PPC Ads, Leads Generation, Content Marketing, Mobile Marketing, Email Marketing and all forms of available internet marketing. It has a team of experts with experience of 12 years in industries who believe in providing world-class marketing services to deliver best results to our clients. Reach our experts to get a Free Digital Marketing Consultation for your business.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Digital Screw

    Digital Screwcertified-flagverified-flag

    (0 review)
    We are an enthusiastic bunch of digital screws who continuously thrive towards meeting your goals and expectations. We provide digital marketing solutions such as social media marketing/search engine optimisation/ web designing and lot more. We currently have a clientele consisting of companies from healthcare, FMCG, e-comm, education, IT, pharmaceutical and hospitality sector. We have a 100% client retention and keeping them happy is our first priority.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Konvert Klicks Private Limited is a digital marketing agency in India. We offer our services to a wide variety of international customers, large and small to achieve online success. For more information, contact us at +91-9977001318 / 9993588111. We are a leading digital marketing agency in India, it’s a service-based agency that provides solutions to grow your business. The company expertise in the field of SEO, PPC, Social Media Marketing, Local SEO, Email Marketing, ORM, etc. Our team develops effective content strategies for forward-thinking companies. We have a proven track record in increasing search engine rankings.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Next Hyperlink

    Next Hyperlinkverified-flag

    (0 review)

    Crafting Your Digital Destiny

    At Next Hyperlink, we are a leading web development agency that specializes in creating custom websites for businesses and individuals. We offer a comprehensive range of services, including website design, development, maintenance, optimization, and hosting. Looking for a reliable web development agency in Ujjain? Choose Next Hyperlink. We specialize in custom website design, development, optimization, and secure hosting. With a customer-centric approach, we deliver tailored solutions to meet your unique requirements. Stand out from the competition and achieve online success with Next Hyperlink. Contact us today to discuss your web development needs and let us take your business to new heights.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €500 for Social Media
  • BBM Digitech

    BBM Digitechcertified-flagverified-flag

    (0 review)
     
    No work in Social Media
    Active in Madhya Pradesh, India
    From €100 for Social Media
  • Bharat packers and movers is an awarded ISO 9001:2008 company and known as best packers and movers for its expertise in home and office shifting, car transportation, industrial goods packing and moving, and other movers and packers services. At Bharat packers and movers , we use the best quality materials for packaging and provide doorstep delivery of all your quality goods. With Bharat packers and movers,  shifting your home and office goods, car, bikes or any other item could be a hassle and tension free.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Afzal Khan - Certified Digital Marketing & SEO Consultant

    Afzal Khan - Certified Digital Marketing & SEO Consultantcertified-flagverified-flag

    (0 review)

    Helping business to create and increase their Brand online!

    We’re a close team of Digital Marketing Strategists, SEO Consultants, E-commerce SEO Optimization & Social Media Marketing Experts, Graphic Designers & Web Developers who work together to create beautiful, engaging digital experiences. We help startups, large, medium and enterprise level companies from all over the world materialize their ideas into great success online! We tackle business problems with intelligence. We use cutting-edge tech and cutting-edge thinking to bring BRANDs to life online & direct consumer behavior. We take pride in delivering only the best.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • DigiRank360

    DigiRank360certified-flagverified-flag

    (0 review)

    Show your business and grow your business..

    Digirank 360 is a Digital Marketing company based in the Prime location of M.P. Nagar, Zone-1, Bhopal. We provide Online Marketing services such as Search Engine Optimization, Social Media Marketing, Lead Generation, E-mail Marketing, Website design and development, and many premium services relates to paid advertising on Google, Facebook, and Instagram. You can consult with our digital marketing experts about marketing strategies that best suit your business, products, or services.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Infowind Technologies (IT) Pvt. Ltd.

    Infowind Technologies (IT) Pvt. Ltd.certified-flagverified-flag

    (0 review)

    Turning Tech into Asset

    Infowind Technologies believes that the software has the power to transform business insights in today’s digital era. Being the leading website and mobile application development company in India, we have empowered every business model whether it be start-up, small or mid-size organization, enterprise, or agency. Our crafted solutions have helped our clients achieve success and gain a competitive edge over others.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • "We are here to fulfil your needs to grow your business Orphic Solution - Best digital marketing company in Bhopal has a unique approach to Digital Marketing and Content creation can help you connect with your target audience and increase sales to give the best ROI. Our Services Includes Best SEO Services in Bhopal, Best SMO Services in Bhopal, and Best PPC Services in Bhopal"
    No work in Social Media
    Active in Madhya Pradesh, India
    From €200 for Social Media
  • White Elephant Tech

    White Elephant Techcertified-flagverified-flag

    (0 review)

    Dream Innovative

    White Elephant Tech is a centralized digital marketing company located in Indore. We helped 1000 plus businesses grow online. Our expertise in Social Media Marketing, Search Engine Optimization, Pay Per Click, Email Marketing & more. Being the best digital marketing agency, we focus on building your online presence.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €70 for Social Media
  • Digital Marketing Indore(Reliable Digital Expert) is a leading company from Indore, (mp), India helping businesses in their digital promotion through their suite of web, Mobile applications, and Digital Marketing Services. We only focus on quality deliverables which brought us to where we are now. All our projects go through different layers of testing and quality assurance. Take care of all the issues that may come even after project completion. How do we work? Being experts in web design, App development, SEO, and Social Media Marketing, our creative designers know “How to convert a visitor into a customer” it also depends on how well you will Appear in front of your customer. Whether your organization is small, medium, or large, we assist all types of businesses in building their professional web presence.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Digileaf

    Digileafcertified-flagverified-flag

    (0 review)
    No work in Social Media
    Active in Madhya Pradesh, India
    From €37 for Social Media
  • Artotion Studio Pvt Ltd

    Artotion Studio Pvt Ltdcertified-flagverified-flag

    (0 review)

    an ocean of art

    Artotion Studio is a creative company, that provides premium 2D quality art and Animations. Many international publishers choose to work with us because of our high-quality standards and very competitive rates.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Techmatrick Digital Solutions

    Techmatrick Digital Solutionscertified-flagverified-flag

    (0 review)

    We love overcoming design, technology, and marketing challenges to elevate our client's success.

    TechMatrick is a tech-enabled full-service digital marketing solutions provider. We work with customers from all over the world including the United States, Singapore, Canada, and the UK to create custom strategies for each of our clients based on their needs and goals. As a full-service digital marketing agency, we provide web design, internet marketing, SEO, social media, PPC, email marketing, content writing, and web & app development to businesses large and small that are looking to broadcast their messages more efficiently.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €999 for Social Media
  • Sprout Pixel

    Sprout Pixelcertified-flagverified-flag

    (0 review)

    We help Small, Medium, & Large businesses grow digitally through modern Digital Marketing strategies

    "We are an Indore-based Digital Marketing Agency offering services to our clients worldwide. We focus on the ultimate marketing funnel approach to convert leads into conversions that finally results in business growth. In a short span of time, our team has achieved valuable results for our clients helping them achieve the business growth they have always wanted. May it be taking your business online by designing a website, or increasing your presence on Social Media through organic or paid means, or getting your website ranked on search engines like Google, Yahoo, or Bing, we’ve got everything covered for you. Get in touch with us today for Digital Marketing Services in Australia and Digital Marketing Services in USA. Our services include - Search Engine Optimization (SEO Services) - Social Media Marketing and Management (SMM) - Website Design services - Google Ads - Graphic Design services - Virtual Assistant services"
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • No work in Social Media
    Active in Madhya Pradesh, India
    From €10 for Social Media
  • Graphic 360

    Graphic 360certified-flagverified-flag

    (0 review)

    Go Creative, Go Viral - Best Graphic designing company in Indore

    Graphic 360 was established in 2016 and within this short period, it has proved to be one of the leading full services web design and marketing firms operating in Indore. We provide clients with various web-based and marketing communications solutions, from corporate identity and logo design, brochure design, infographics, PPT presentation design event branding to online & offline marketing and web design Services, digital marketing, search engine optimization, and social media marketing. We also offer our clients motion graphics for pre-wedding ideas and invitations.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €11 for Social Media
  • Klickstorm Solutions

    Klickstorm Solutionsverified-flag

    (0 review)

    Leading Digital Marketing Agency

    Klickstorm Solutions: Empowering Your Digital Success At Klickstorm Solutions, we are passionate about transforming businesses in the digital landscape. As a leading digital marketing agency, we specialize in crafting tailored solutions to elevate your brand, engage your audience, and drive tangible results. Our talented team of experts excels in a wide range of services, including SEO, PPC advertising, social media marketing, content creation, and web design. We leverage data-driven strategies and the latest industry trends to ensure your online presence is dynamic and competitive. With a client-focused approach, we take the time to understand your unique needs, goals, and challenges. Whether you're a startup or an established enterprise, our solutions are designed to align with your vision and deliver exceptional value. Transparency, innovation, and customer satisfaction are at the core of everything we do. Partner with Klickstorm Solutions today and experience the power of digital marketing that propels your business to new heights. Together, let's thrive in the digital world.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • https://alfyi.com/

    https://alfyi.com/certified-flagverified-flag

    (0 review)

    Your Source for Logo, UI/UX, WordPress, and Digital Marketing Excellence.

    Alfyi is a team of highly skilled designers and experienced developers who share a deep passion for creativity, storytelling, and problem-solving. Our specialisation encompasses WordPress design and development, UI/UX design, logo creation, and digital marketing. We strongly believe in the transformative potential of exceptional design. We hold the conviction that when design is executed with precision, it transcends barriers, communicates universally, and makes a lasting first impression. Alfyi proudly boasts over 8 years of invaluable experience in the field.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Bloom Media

    Bloom Mediacertified-flagverified-flag

    (0 review)

    Bloom Media is situated in Indore, established seven years software products & IT solutions company

    Bloom Media is situated in Indore, established seven years ago. Bloom Media is a specialized software products & IT solutions company that builds powerful and creative company-driven solutions. Our expert experts and digital marketer utilize their extensive abilities, extensive knowledge, and logical experience to make a difference for start-ups and large businesses with a solid international existence. We raise the aesthetic appeals and also the capability of your websites. It is still our most excellent suit, and also we are incomparable when it comes to Creative Web Design Company In Indore. We transformed the way companies came close to Website Designing in India. Our designers and designers are working from the ground up to optimize the sites for online search engines. Our Digital Marketing Firm has an experienced & professional group who are effectively working on most current technologies/tools to find superb execute on different internet based projects. We supply a specialist, regional, and hands-on experience to develop your website layout or redesign throughout.
    No work in Social Media
    Active in Madhya Pradesh, India
    No budget for Social Media
  • GoMaxoo Digital

    GoMaxoo Digitalcertified-flagverified-flag

    (0 review)

    Maximize Your Business With Us.

    GoMaxoo is your go-to digital marketing agency, specializing in strategies that connect businesses with their audience. With expertise in SEO, PPC, social media, content creation, and email marketing, we tailor solutions to meet each client's unique needs. Committed to staying ahead in the digital landscape, we provide creative and effective solutions to help businesses thrive. Our collaborative approach ensures clients are informed and engaged throughout the process. Whether you need improved website visibility, increased traffic, or enhanced leads and sales, GoMaxoo has the experience to achieve your goals. Contact us today for digital success. We help with growth issues: => Getting Good Leads & Sales => Making customers happy => Keeping the brand strong => Staying high on search engines => Getting more money from ads
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Yuvau Digital

    Yuvau Digitalcertified-flagverified-flag

    (0 review)

    Grow Your Business Online

    Yuvau Digital is a Service-Based firm Offering Social Media Marketing, Facebook - Instagram Advertising, Bulk SMS & Whatsapp Marketing, PR & Social Media Verification Services to businesses, Startups, brands & Organisations.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Healthcare Marketo is your trusted partner in healthcare marketing. Specializing in tailored digital solutions for B2B healthcare organizations, we have an unparalleled understanding of the healthcare marketing landscape. Whether your audience includes patients or providers, we excel in reaching them effectively. Partnering with us means collaborating with industry experts who have in-depth knowledge of the Clinic & Healthcare Marketing Agency sector. Our services include boosting your online presence, optimizing for local searches, executing targeted ad campaigns, and generating leads. Additionally, we offer custom website design, compelling content creation, reputation management, and engaging video production. From start to finish, we cover all aspects necessary to enhance your brand and attract new clients. If you're ready to elevate your healthcare business's online presence, Healthcare Marketo is here to help you achieve your goals.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Digitly |2023 Award Winner in SEO, Social Media, PPC

    Digitly |2023 Award Winner in SEO, Social Media, PPCverified-flag

    5
    (24 reviews)

    Software Made Better. Marketing Made Simpler.

    Recommended
    Award-winner
    Grow Holistically with Digitly - 2023 Award Winning Digital Marketing Agency Welcome to Digitly, your trusted partner in digital marketing and technology solutions. With a strong global presence, we have successfully collaborated with clients across 30+ countries. Our expertise spans various industries, including pharma, healthcare, real estate, IT/ITes, engineering, manufacturing, technology, e-commerce, education, and FMCG. As an authorized Google partner , Digitly combines cutting-edge strategies and innovative technologies to deliver exceptional results. Recognized as a leader at the 2023 TechBehemoths Awards(SEO, SMM, PPC) , our expertise speaks volumes. We don't just talk results, we deliver them, proven by prestigious accolades. At Digitly, we understand that every business is unique. That's why we tailor our services to meet your specific needs and goals. Whether you're looking to boost your brand presence on social media, enhance your website's visibility through search engine optimization (SEO), manage effective paid ad campaigns, develop custom WordPress solutions, create user-friendly websites, software, and mobile apps, or establish a robust e-commerce platform, our team of experts is here to assist you. With our expertise in social media marketing, search engine optimization, paid ads management, custom WordPress development, website, software testing, and mobile app development, eCommerce website development, creative designs, and video productions, we have the tools and knowledge to elevate your digital presence and drive tangible results for your business. Experience the power of Digitly and unlock your company's true potential. Our services: - Social Media Marketing - Search Engine Optimization (SEO) - Paid Ads Management - Software Testing AWARDS Top SEO Company in India in 2023 https://bit.ly/SEOAward2023 Top SMM Company in India in 2023 https://bit.ly/SMMAward2023 Top Pay Per Click Company in India in 2023 https://bit.ly/PPCAward2023
    6 works in Social Media
    Active in Madhya Pradesh, India
    From €300 for Social Media
  • zazzy

    zazzycertified-flagverified-flag

    4.2
    (6 reviews)

    We build digital products for forward-thinking brands that make users go WOW.

    Recommended
    Award-winner
    We help forward-thinking brands with strategy, branding, design & marketing. We design digital experiences that are so awesome they'll make your grandma want to learn to code. We are wild about fonts and go wild over graphics! We're a bunch of creative weirdos who thrive on turning boring briefs into eye-popping masterpieces. We don't just design stuff; we create visual adventures that take brands on a rollercoaster ride of awesomeness. Some of the brands we have worked with: Nickelodeon, Hudson, Moengage, Tedx, AIOps, Tyke, Ogilvy, Ford, Mapro, Falero, KukuFM, Pathfinder, Strategy Connect, GoldenPi, Rulezero, IIT Ropar, etc.
    2 works in Social Media
    Active in Madhya Pradesh, India
    From €600 for Social Media
  • Analog Digital Solution

    Analog Digital Solutioncertified-flagverified-flag

    5
    (1 review)

    Seeding to Success. Co-Pilot in your Growth

    Award-winner
    Analog Digital Solution specializes in crafting strategic, impactful brand identities and customer experiences for startups. Offering a spectrum of services including Visual Identity Design, UI/UX Design, Brand Strategy, Rebranding, Product Positioning, Packaging Design, Product Photography, Animated Videos, Experience Center Design, and MVP Development, we are your one-stop studio, ensuring designs are not just aesthetic but also practically impactful and strategy-driven. Branding Agency for Startups
    3 works in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • TheConversions is a full-service SEO company based in India, but delivering to customers across the globe and industries. It’s a consortium formed by 4 SEO professionals, each having 10 years plus experience. Our strong team of 50+ SEO experts have experience of handling over 2000+ clients. Our team consists of 20+ linguistic experts with absolute command over multiple International languages. We have 10 + highly trained and experienced and qualified staff to fine tune technical aspects of websites and to deliver high quality web solutions to global businesses. We leverage our knowledge base to deliver the finest and profitable solutions that meet customers’ needs. We explore your business and focus on optimising your web presence. Our team knows how to add real value to online businesses. We provide services to both B2B as well as direct clients. In B2B, we provide white label services to strengthen every single element of end client’s website. We devise and execute the most scalable and reliable SEO and conversion strategies to improve websites’ performance. Our SEO specialists adjust your clients website according to the norms to achieve maximum visibility and traffic. We also offer a FREE SEO CONSULTATION service and a comprehensive website analytical report to highlight key strengths and weaknesses of your website. We utilize advanced tools and techniques to provide you the cutting-edge solutions so that you can dominate the market and achieve optimum ROI. We have everything to win the battle, such as: Industry expertise (years of relevant experience) Managerial approach Smart team (business analyst, programmers, SEO specialist) Solid infrastructure (fully operational labs with advanced software suites) Linguistic capacity (20+ linguistic professionals) Technical expertise (10+ web development professionals) We manage all the dimensions of SEO to plan, organize, control and implement key changes to gain better result  
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Best Digital Marketing Company in Indore, Best SEO services Indore, Social media marketing services Indore - Affordable, Result Guaranteed Call: +91-7974881696
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Track All Digital AKA TAD is launched to help SMEs and Businesses specially which are small and have good business potential but have no or little digital presence. As we know technology is growing at the rocket speed, there is so much need for businesses to match that speed and adapt the current technology and algorithm changes. Be it Social Media platforms like Facebook, Instagram, LinkedIn, Twitter, Pinterest, YouTube etc. or be it Search Engines like Google or Bing, you would want your business offerings to be on the top when someone searches for you online so that they could find you and get your information. This qualifies your chances to grow your number of leads. We Believe In – “EVERY ONE IS PLAYING THE SAME GAME. BUT IN DIFFERENT WAYS”
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Best Digital Marketing Training in Bhopal & SEO course in Bhopal, Offering SEM, ORM, PPC, SMM, website designing Training & development company in bhopal. Digital Marketing Company in Bhopal and SEO Company in Bhopal
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • White Globe Web

    White Globe Webcertified-flagverified-flag

    (0 review)

    White Globe Web is a leading digital marketing company in Jabalpur

    White Globe Web is digital marketing company in Jabalpur that helps you stay ahead of your competitors as far as your digital advertising campaign is concerned. We offer time bound, advanced and cost-effective solutions to your digital marketing needs. Our services include SEO (Search Engine Optimization), PPC (Pay Per Click), SMM (Social Media Marketing), Content Marketing, App Marketing, Web Development and Website Designing. We offer all services under one roof. We undertake complete digital marketing campaign starting from scratch to finish. With more focus on target audience, targeted geographical area, and with measured results, our clients can focus more on their core businesses, instead of running from pillar to post for each and every small thing for their digital marketing campaigns. We have expert teams of each service that help clients to focus on their core business, rest things are managed by our professional teams.time-bound, “We invite you to become a member of our client community”.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • vpadmarketing

    vpadmarketingcertified-flagverified-flag

    (0 review)
     
    No work in Social Media
    Active in Madhya Pradesh, India
    From €100 for Social Media
  • About Syntax   Syntax to craft Mantra to relax Syntax Mantra is the only mantra that frames your business with a unique code of advanced technology, transformation, and innovation. Syntax Mantra moves ahead as a software development company that transforms business with its unique Coding Mantra and makes any business stand in the crowd followed by loyalty, transparency, and trust.   What we do!   Our true intention is to grow with you. We shake hands with every possible industry and drive the process with smart efforts in order to make any project worthy. Our hassle-free process just goes with the flow of: Brief | Action | Desired Results   What You Have To Do! Just sit back and let us chant this mantra for you and get the desired results.     Syntax Mantra Always coding roots Syntax Mantra is serving various industries with its extremely smart efforts and bringing its clients to the top with professional web design & development, mobile app design & development, and the best digital marketing services in India. With years of experience, the company has marked its footprints with 360-degree online innovative services.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Web & Links Park

    Web & Links Parkverified-flag

    (0 review)

    Grow Your Business Digitally

    With an Aim to Take Your Business to a Higher Orbit of Growth Through Cutting Edge Innovative Services & Solutions, Web & Links Park is Now Open With a Wide Range of Digital Services Right from SEO, SEM and SMM to Digital Marketing, Branding and Design/UX.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • QuikViral

    QuikViralcertified-flagverified-flag

    (0 review)

    Digital Marketing with Real Results

    Who We Are? Quik Viral is a leading provider in the Digital Industry with over 10+ years of experience. We are a team of creative minds looking to help businesses grow digitally and find the best solutions for you. We strive to integrate your goals with our goals. What We Do? Quik Viral primarily focuses on delivering Smart, Creative, and Customized Digital Solutions. Our digital marketing services include Search Engine Optimization (SEO), Search engine Marketing (SMM), Social Media Marketing (SMM), Graphic Designing, Email Marketing, Web Designing, Web Development & App Development, and E-Commerce Solutions. Quik Viral always presents your business ideas with creativity in front of your customers. At Quik Viral, we believe in delivering quality services that lead to desired results.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Web Development India

    Web Development Indiacertified-flagverified-flag

    (0 review)

    Award Winning Website Development Company in India

    Web development in India focuses on improving the digital experience of website users in order for business owners to increase sales. Web Development India offers PHP Development, Laravel Development, and WordPress Development, Website Development etc.Their high-quality, end-to-end Web developers are known for creating websites that are both sturdy and feature-rich. They make your company's website look professional and user-friendly. It is a well-known and reputable PHP Development Company, Laravel Development Company, and WordPress Development Company that has been serving the public for over a decade. Despite the fact that it is founded in India, it has built a strong and dedicated global clientele over the years. They never fail to deliver an above-average WordPress website in a reasonable amount of time. Their skilled pros can guarantee you a ground-breaking website that will increase your revenue by utilising cutting-edge technologies at all times.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Revex Media

    Revex Mediaverified-flag

    5
    (4 reviews)

    Revenue with Experience

    Recommended
    Revex Media is one of the fastest-growing integrated digital agencies working with thriving brands to scale their digital presence and top-line revenues with data-backed & innovative marketing & sales strategies. Revex focuses on growing business & building brands leveraging digital channels & marketing intelligence. We have worked on 100+ projects and manages 50+ brands' marketing & sales operations. We are a team of 35+ performers and creators motivated to scale brands to their full potential with innovative marketing solutions, advanced technology, and deep consumer insights.
    9 works in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • Experts in building digital marketing strategies that work and generate the desired results for our clients.
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media
  • AM Infotech

    AM Infotechcertified-flag

    (0 review)
     
    No work in Social Media
    Active in Madhya Pradesh, India
    From €1000 for Social Media

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


What can you anticipate from an associate specialised in social media marketing in the region of Madhya Pradesh!

Sortlist helps you find the best agency in Madhya Pradesh

In the whereabouts of Madhya Pradesh but also elsewhere is, thanks to Sortlist, encountering a marketing bureau child's play, fast and transparent. Sortlist possesses a list containing a mass of high-quality communication agencies worldwide. The unique thing still left for your company is to determine with which one your firm wishes to become partners.

Smoke out a social media agency in Madhya Pradesh.

our team's intention is to write an index of the 5 optimal social media agencies for your activity. And they will thus, thanks to their expertise and competencies, create quality for your campaign in social media marketing or social media accountmanagement. Thus trust us, the bureaus in Madhya Pradesh will have every little thing on a tight rein.

Madhya Pradesh, a mountain of perks to collaborating with a social media agency.

A undeniable perk of collaborating with a professional bureau is that your company can aim it’s attention on what it can do best. And the expertise, proficiency and technology of the social media agencies in Madhya Pradesh will ensure that your assignment will be delivered to a prosperous conclusion.

Start activities in social media marketing in Madhya Pradesh.

social media agencies have loads of distinct techniques, for example, they are highly skilled in social media communication and social media marketing. Contacting a social media agency for your future campaign in Madhya Pradesh will capacitate your company create an valuable and reasoned social media marketing game operation for your firm.

Is your company drafting a campaign in social media marketing, or is your firm looking for a company expert in social media marketing for a campaign in social media accountmanagement? Then your company will certainly find your forthcoming associate near Madhya Pradesh on us. And considering we pick out our companies based on well-defined benchmarks, your firm can rest on the fact that the bureaus your company will meet through our algorithm will be certified and able to satisfy your requirements.

Our listing incorporates a myriad of firms globally, so if your firm are searching for a associate in Madhya Pradesh then we are certain he is in our listing. You will, when your firm has dug out its firm, launch an integral program to manage the activity of your company.



Advertising Agencies in Madhya PradeshBranding Agencies in Madhya PradeshContent Marketing Agencies in Madhya PradeshCopywriting Agencies in Madhya PradeshDigital Marketing Agencies in Madhya PradeshEmail Marketing Agencies in Madhya PradeshEvent Companies in Madhya PradeshGrowth Marketing Agencies in Madhya PradeshInfluencer Marketing Agencies in Madhya PradeshMarketing Agencies in Madhya PradeshMedia Agencies in Madhya PradeshOnline Advertising Agencies in Madhya PradeshPrint Companies in Madhya PradeshPublic Relations (PR) Agencies in Madhya PradeshSEO Agencies in Madhya PradeshSocial Media Agencies in Abu DhabiSocial Media Agencies in AmsterdamSocial Media Agencies in Atlanta, GASocial Media Agencies in Austin, TXSocial Media Agencies in BangkokSocial Media Agencies in BarcelonaSocial Media Agencies in BengaluruSocial Media Agencies in BerlinSocial Media Agencies in Boston, MASocial Media Agencies in BucharestSocial Media Agencies in Cape TownSocial Media Agencies in ChicagoSocial Media Agencies in Dallas, TXSocial Media Agencies in DubaiSocial Media Agencies in DublinSocial Media Agencies in HoustonSocial Media Agencies in JohannesburgSocial Media Agencies in MelbourneSocial Media Agencies in Miami, FLSocial Media Agencies in MilanSocial Media Agencies in MontrealSocial Media Agencies in ParisSocial Media Agencies in Philadelphia, PASocial Media Agencies in San DiegoSocial Media Agencies in San FranciscoSocial Media Agencies in SeattleSocial Media Agencies in SharjahSocial Media Agencies in SingaporeSocial Media Agencies in StockholmSocial Media Agencies in SydneySocial Media Agencies in Vancouver