The 10 Best Digital Marketing Agencies in Colombia (2024)

Best Digital Marketing Agencies in Colombia

Featured providers

  • High Results

    High Resultscertified-flagverified-flagfeatured-flag

    (0 review)

    Connecting Worlds

    Award-winner
    Somos comunicación estratégica. relaciones públicas y marketing digital. ¡Apoyamos sus objetivos de negocio! Generamos estrategias de comunicación enfocadas en la visibilidad y recordación de las marcas, productos y servicios para mejorar el posicionamiento frente a las audiencias. Hemos trabajado con cerca de 250 compañías , de la mano de un equipo multidisciplinario y un equipo directivo con más de 23 años de experiencia . Con presencia didrecta en diferentes países de Latinoamérica gracias a nuestra equipo de consultores    
    2 works in Digital Strategy
    Active in Colombia
    From €3000 for Digital Strategy
  • ABC DIGITAL (by ABCW)

    ABC DIGITAL (by ABCW)certified-flagverified-flagfeatured-flag

    4.6
    (11 reviews)

    Se parte de la Revolución Digital Global

    Recommended
    Award-winner
    ABC Digital es una de las agencias holding de ABCW, contamos con más de 12 años de experiencia en el mercado y contamos con el mejor talento internacional. Hemos sido reconocidos como "la mejor agencia de publicidad internacional" por Merca 2.0. Contamos con más de 200 colaboradores que se encargan de crear estrategias digitales integrales, innovadoras y a la vanguardia de las tendencias globales de marketing digital. Algunos de nuestros servicios son: SEO, gestión y manejo de redes sociales, campañas publicitarias en medios digitales, estrategias de inbound marketing y desarrollo de sitios web, e-commerce, aplicaciones móviles y landing pages con alta experiencia de usuario e interactividad. Algunos de nuestros clientes son: Playa Resorts, EY, Energizer, Maple Bear, Panasonic, entre otros, con los cuales hemos logrado llevar sus resultados a otro nivel. Actualmente somos Google Premier Partners, Meta Business Partners, Hubspot Partners y contamos con acceso a Amazon Web Services, aportando alto valor en las estrategias de cada uno de sus clientes. 🇺🇸 https://abcdigitalagency.us/ 🇲🇽 https://www.abcdigital.mx/ 🇨🇴 https://abcdigital.com.co/
    3 works in Digital Strategy
    Active in Colombia
    From €800 for Digital Strategy

Best Digital Marketing Agencies in Colombia

Sort by
  • GB Media Group

    GB Media Groupcertified-flag

    (0 review)
     
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • BACKBONE

    BACKBONEcertified-flag

    (0 review)
    BACKBONE helps businesses to tap into their true business potential through sustainable, high-end digital business solutions and has offices in Canada, Greece, Colombia and Mexico.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Creceri

    Crecericertified-flag

    (0 review)
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Ashara Studios

    Ashara Studioscertified-flag

    (0 review)
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Fenix Alliance Web Portal
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • The owner of this domain has not yet uploaded their website.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Casa del Media

    Casa del Mediacertified-flag

    (0 review)
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • COS

    COScertified-flag

    (0 review)
    Nuestros servicios de Contact Center, Call Center y BPO se adaptan a cualquier tipo de mercado. ¡Conócenos y toma la mejor decisión!
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • datasocial

    datasocialverified-flag

    4.9
    (75 reviews)
    Award-winner
    Somos expertos en RevOps e Inbound Marketing Y también tu aliado para... Optimizar plataformas tecnológicas. Centralizar y unificar tus procesos. Acelerar motores de ingresos. Generar modelos de eficiencia. Implementar automatizaciones. Rentabilizar costes. Aumentar el ratio de conversión. Tomar el control.
    18 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Coco Solution

    Coco Solutioncertified-flagverified-flag

    4.5
    (14 reviews)

    Top Online-Marketing

    Recommended
    Award-winner
    ᴇꜱ Somos una Agencia de Marketing Digital 360º que colabora con marcas que buscan dejar huella. Creemos que con la mezcla adecuada de estrategia y creatividad, no hay imposibles. Estamos especializados en el desarrollo de páginas web y aplicaciones, el diseño gráfico, el posicionamiento SEO , el SEM y las redes sociales, entre otros muchos servicios. Queremos ser parte de tu proyecto y trabajar de la mano contigo para acompañarte hasta donde quieras llegar... ¡y mucho más allá! ¿Preparado para el cambio? ᴇɴ We're a 360º Digital Marketing Agency that works with brands who want to make an impact. We believe that, with the right mix of strategy and creativity, nothing is impossible . We specialise in website and app development , graphic design , SEO positioning , SEM and social media , among many other services. We want to be part of your project and work hand in hand with you to take you as far as you want to go... and beyond! Are you ready for a change? ᴅᴇ Wir sind eine 360°-Digitalmarketing-Agentur , die mit Marken zusammenarbeitet, die etwas bewirken wollen. Wir glauben, dass mit der richtigen Mischung aus Strategie und Kreativität nichts unmöglich ist . Wir sind spezialisiert auf App- und Webentwicklung , Grafikdesign , SEO-Positionierung , SEM und soziale Netzwerke , neben vielen anderen Dienstleistungen. Wir wollen Teil deines Projekts sein und Hand in Hand mit dir arbeiten, um dich so weit zu bringen, wie du es willst - und darüber hinaus! Bist du bereit für eine Veränderung?
    18 works in Digital Strategy
    Active in Colombia
    From €200 for Digital Strategy
  • Ingeniería Digital

    Ingeniería Digitalverified-flag

    5
    (5 reviews)

    Consultora digital que enfoca en el crecimiento de tus ventas mediante herramientas digitales

    Recommended
    Ingeniería digital Es una consultora digital líder en innovación, desarrollo y programación de aplicaciones, plataformas digitales y webs. Usamos el diseño UX / UI como guía pero nos enfocamos en los resultados. Ingeniería digital It is a leading digital consultancy in innovation, development and programming of applications, digital platforms and websites. We use UX / UI design as a guide but focus on results.  
    3 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Tamarindo Lab

    Tamarindo Labcertified-flagverified-flag

    5
    (2 reviews)
    Recommended
    We are a group of experts in the development of Web, App, Software, Marketing and Digital Analytics projects, with more than 8 years of experience. We are dedicated to creating digital assets that offer a unique user experience .
    3 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Cygnus Dzine

    Cygnus Dzinecertified-flagverified-flag

    (0 review)
    CYGNUS DZINE nace en el año 2010, como un Studio de diseño gráfico | web. Creemos que la imagen gráfica debe representar la identidad del cliente como una obra de arte, nuestro propósito es causar en el espectador emociones que hagan de la marca algo inolvidable y así consolidar el interés y reconocimiento por sus clientes de forma duradera y estable en el tiempo. En los últimos años hemos ido ganando experiencia y reconocimientos en el área de diseño digital, con propuestas que salen de lo tradicional. Combinamos la publicidad tradicional con las nuevas tecnologías en comunicación. Contamos con presencia en la ciudades de Caracas y Chile, y a nivel mundial a través de Internet. Nuestra principal plataforma de trabajo es Internet, una vasta red que crece día a día, contando en el presente con cientos de millones de usuarios alrededor del mundo. La web ha revolucionado la forma en que se comunican e interactúan las personas entre si y con las marcas. Un medio lleno de oportunidades para quienes cuenten con las herramientas adecuadas. Para eso nos hacemos cargo de descubrir lo que deseas transmitir y crear a través de una comunicación visual la mejor oferta de su marca. Nuestra misión, entender a nuestros clientes y sus necesidades, ofreciéndoles estrategias a la medida, fusionando las nuevas tecnologías con los medios tradicionales.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Páramo - Agencia de Publicidad Estratégica

    Páramo - Agencia de Publicidad Estratégicaverified-flag

    4.8
    (14 reviews)

    Impulsamos tu negocio con creatividad que performa

    Recommended
    Creemos que el performance con ideas, genera más y mejores resultados. Tenemos más de 18 años de experiencia en Marketimg, publicidad y comunicación y 5 años en el mercado como Páramo. Trabajamos el funnel completo de nuestros clientes, creando estrategias donde la idea y el performance se mezclan para lograr resultados.
    5 works in Digital Strategy
    Active in Colombia
    From €600 for Digital Strategy
  • Oso Gordo Lab

    Oso Gordo Labverified-flag

    5
    (9 reviews)

    Laboratorio de ideas.

    Recommended
    Award-winner
    Oso Gordo Lab es una agencia creativa con 8 años de experiencia que realiza videos animados 2D, corporativos, publicitarios y videos pizarra whiteboard. Hemos trabajado para clientes como Coca-Cola, Cruz Roja y Astrazeneca.
    2 works in Digital Strategy
    Active in Colombia
    From €500 for Digital Strategy
  • Dayvo Sistemas

    Dayvo Sistemasverified-flag

    4.4
    (8 reviews)
    Recommended
    Award-winner
    Somos una empresa de diseño web y marketing online con 15 años de experiencia. Somos de León, pero en los últimos años hemos comenzado nuestra expansión internacional y contamos con una sede en Medellín (Colombia) y otra en Los Ángeles (Estados Unidos). Nuestro propósito siempre ha sido integrar a las empresas en el mercado online ayudándolas a aprovechar las oportunidades que ofrece Internet para mejorar los resultados de su negocio. Aunque contamos con todo tipo de empresas entre nuestros clientes, lo cierto es que la gran mayoría son autónomos, microempresas y pymes. Uno de nuestros principales valores es el trato cercano y personalizado que ofrecemos a todos nuestros clientes Para muchos de ellos Internet es un mundo desconocido en el que están dando los primeros pasos con Dayvo, por eso, es importante para nosotros, no solo ofrecerles el mejor servicio sino además acompañarles y asesorarles de la mejor manera durante todo el camino online. Ofrecemos servicios de diseño de páginas web personalizadas, desarrollo de tiendas online, gestión de redes sociales corporativas, posicionamiento SEO en buscadores y publicidad en Google (SEM) y en redes sociales. Para dar servicio a todos nuestros clientes contamos con un equipo formado por más de 160 trabajadores especializados en diseño y estrategias de marketing online. Durante estos años estamos orgullosos de haber conseguido importantes partnerazgos con 3 de las más destacadas compañías del ámbito digital.  Así, somos empresa partner de Google, Microsoft y Prestashop.  
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • 3lemon

    3lemoncertified-flagverified-flag

    (0 review)
    Utilizamos la estrategia, la creatividad y la tecnología en todas sus formas (digital, offline, publicidad, comunicación) para ayudar a nuestros clientes a construir marcas relevantes, con ADN propio. BE DIGITAL FIRST Vivimos la cultura digital. Somos irreverentes en las formas y sistemáticos en el fondo. Nos gusta imaginar, analizar, diagnosticar y acompañar.
    7 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Kraken - Agencia Digital Creativa

    Kraken - Agencia Digital Creativaverified-flag

    5
    (1 review)

    We are the beast! 🐙 Enfócate en tu negocio, nosotros nos encargamos del marketing.

    Recommended
    Somos una agencia digital creativa de servicio completo para ayudarte con el crecimiento de tu marca. ¡Gestionamos todo lo que tu marca necesite! Desde la estrategia hasta su ejecución.
    6 works in Digital Strategy
    Active in Colombia
    From €50 for Digital Strategy
  • Izalco Corporate Services

    Izalco Corporate Servicesverified-flag

    5
    (3 reviews)

    Hacemos crecer negocios

    Recommended
    Somos un BPO de servicios como Ingenieria, ventas y marketing. Somos parte fundamental de grandes industrias y el corazón de las empresas al mostrar su marca. Nuestra filosofia es crecer negocios, no importa la idea de negocio que se tenga nosotros la hacemos realidad y nos acoplamos a las necesidades de cada una. Estamos listos para poner en alto y llevar al éxito a grandes industrias. contamos con poder hacer negocios dentro y fuera del país.
    1 work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • gum Agencia Digital

    gum Agencia Digitalverified-flag

    5
    (1 review)

    Marcas que miden lo que importa.

    Recommended
    Award-winner
    A diferencia de otras agencias que se centran en creatividad y métricas de vanidad, como seguidores y likes , nuestra fortaleza principal radica en llevar a cabo sus operaciones de marketing digital diarias a gran escala y medir lo que realmente importa. Creemos que cada empresario debe tener el tiempo necesario para concentrarse en lo que permitirá su crecimiento personal y el de su empresa. GUM Agencia Digital es una agencia de marketing fundada en 2011. Nuestra misión es ayudar a los Empresarios, directores de agencias y gerentes de mercadeo a lograr sus objetivos en áreas clave, permitiéndoles centrarse en el crecimiento de los ingresos y la creación de valor de marca mientras nosotros nos encargamos de ejecutar sus operaciones de marketing digital. Nuestra propuesta de valor es simple pero muy atractiva. Contamos con especialistas en marketing digital distribuidos en España y Latinoamérica, lo que permite adaptar el tiempo y el costo del servicio a las necesidades específicas. Trabajamos con diferentes tecnologías, y nuestro personal está certificado en las principales plataformas. Nuestro modelo de servicio brinda flexibilidad para escalar, lo que facilita la adaptación a cambios estratégicos. Somos una agencia que le permite centrarse en el crecimiento de los ingresos y la creación de valor de marca. Permítanos encargarnos de sus operaciones de marketing digital para que todo lo que necesita hacer es crecer más rápido que nunca. Los gerentes de marketing de más de 69 empresas líderes, ya confían en nosotros para sus operaciones de marketing digital. Reserve una llamada estratégica y comience su transformación de crecimiento hoy mismo.
    3 works in Digital Strategy
    Active in Colombia
    From €50 for Digital Strategy
  • Genosha

    Genoshacertified-flagverified-flag

    (0 review)
    We empower stories, brands and startups through technology, design and communication. To be the largest innovation network  that provides worldwide solutions, imagining and promoting new trends in technology, design and communication. Strategy, Design and Production for Digital Products Digital Products and Experiences Improvement. Production of Digital Campaigns Digital Creativity.
    3 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Cynador Agencia de Marketing

    Cynador Agencia de Marketingverified-flag

    1.6
    (3 reviews)

    Somos ideas, estrategias y experiencias enfocadas al crecimiento de tu marca.

    Recommended
    Award-winner
    SEO El posicionamiento SEO de su sitio web es la estrategia que da más relevancia y visibilidad a sus productos o servicios en los motores de búsqueda E-Commerce Podemos desarrollar una solución de proyecto que genere ingresos en línea. Desarrollo Web Diseñamos y desarrollamos páginas web con usabilidad óptima y una experiencia interactiva. Social Media Desarrollamos comunicaciones innovadoras que construyen marcas y capturan oportunidades Branding Creamos marcas desde cero que se diferencian y perduran en la mente de las personas. Publicidad Desarrollamos estrategias de pauta en Google, Facebook, Instagram (Meta), Youtube, LinkedIn entre otras. Marketing Generamos planes de medios digitales para el posicionamiento de nuestros clientes.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • METAMOD

    METAMODverified-flag

    5
    (3 reviews)

    Comunicación Creativa

    Recommended
    Somos un equipo de expertos en comunicación estratégica y servicios creativos que se especializa en el diseño y desarrollo de sitios web atractivos y personalizados, utilizando las últimas tecnologías para ofrecer soluciones personalizadas y atractivas a nuestros clientes. Nuestro equipo está compuesto por expertos en campos como la comunicación digital, el diseño gráfico, la analítica y el marketing digital. Todos con una amplia experiencia en el sector público y privado, lo que nos permite ofrecer soluciones personalizadas y efectivas para cada cliente. Ofrecemos también servicios de formación y comunicación para ayudar a nuestros clientes a maximizar su presencia en línea. Estos servicios pueden incluir capacitación en el uso de herramientas digitales, estrategias de marketing digital y técnicas de comunicación efectiva. En METAMOD nos esforzamos por proporcionar servicios de alta calidad en el área de la comunicación y el marketing digital para ayudar a nuestros clientes a alcanzar sus objetivos. Trabajamos desde un enfoque estratégico y creativo para apoyar a nuestros clientes en sus esfuerzos de marketing y comunicación.
    No work in Digital Strategy
    Active in Colombia
    From €600 for Digital Strategy
  • LatAIm

    LatAImverified-flag

    5
    (1 review)

    Artificial Intelligence Boutique

    Recommended
    Award-winner
    Welcome to LatAIm – Your Gateway to Transformative AI in Latin America. Based in Panama, we specialize in bridging cutting-edge AI technologies with the unique needs of your business.
    2 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Foonkie Monkey

    Foonkie Monkeyverified-flag

    (0 review)
    Award-winner
    We love innovation! With more than nine years of experience in App development and custom software development, we found that it all starts with a good idea. A powerful one, looking for a change in the behavior of people through creativity, teamwork, and perseverance. We create innovative, beautiful, intuitive, and brilliant products. To get there, we realized that every part of the team must be considered as a really important ingredient to accomplish a product that reflects enthusiasm, compromise, heart, creativity, and enjoyment. In consequence and as our main goal, every single fellow realizes that all the time we spend together is not what usually is known as a job. App development and Custom Software Development is our passion We are three main teams: First, the technology team where the project managers, developers, architects, and IT specialists create innovative solutions of high quality for all challenges proposed. Second, the Art team’s daily labor is a pursuit of creativity, great user experience, and beauties in the design of the solutions. Every day is a discovery of new ideas and challenges. And last but not least, the digital marketing team creates great strategies helping new projects be well known for all targets defined for each product.  
    2 works in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Innova Marketing Solutions

    Innova Marketing Solutionsverified-flag

    5
    (2 reviews)

    Business Growth Agency

    Recommended
    Somos una Agencia de Crecimiento enfocada en generar citas con prospectos calificados y ventas a base instalada para empresas interesadas en expandir su negocio. Nos destacamos por nuestro enfoque en resultados comerciales alineados con las metas de nuestros clientes, utilizando las plataformas tecnológicas más avanzadas del mercado junto con la implementación de la Estrategia más efectiva en la actualidad, Inbound Marketing, como Partner Oficial de HubSpot . Nuestra visión se basa en crecimiento sostenible de mediano y largo plazo, por lo que desarrollamos relaciones duraderas con nuestros clientes, colaboradores y socios comerciales. Así que únete y crece con nosotros .
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Software Factory Nnodes

    Software Factory Nnodesverified-flag

    5
    (2 reviews)

    Software factory. Solutions focused on the digital experience to achieve the best results.

    Recommended
    We help companies create digital solutions and experiences that surprise and deliver a competitive advantage in the market. We develop Custom Software, Web Platforms and highly scalable Mobile Applications. In addition, the generation of algorithms, process automation and integrations with APIs are part of our services. We have a team of professionals 100% trained to solve any technological challenge that arises during Software Development and who will collaborate in the digital transformation you need.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • KLIKS Digital - Growth Marketing

    KLIKS Digital - Growth Marketingverified-flag

    5
    (1 review)

    Somos La Agencia de Marketing #1 en España y Latinoamérica especialista en LinkedIn.

    Award-winner
    🚀 Las soluciones y servicios de Kliks ayudan a las empresas B2B a llenar su pipeline de ventas y reclutar candidatos. ¿Estás cansado de perder tiempo con técnicas de prospección obsoletas? ¿Quieres aprovechar las últimas herramientas y estrategias para generar oportunidades y cerrar más ventas? Kliks te ofrece soluciones completas para la prospección B2B. Con nuestros servicios, podrás: ▶︎ Generar cientos de leads cualificados en LinkedIn y por correo electrónico ▶︎ Realizar un seguimiento de tus oportunidades hasta el cierre ▶︎ Encontrar candidatos ideales para tu empresa ▶︎ Generar contenido de calidad y atractivo para Linkedin ▶︎ Mejorar tu posicionamiento web con nuestro servicio de SEO ¿Quieres saber más? Solicita una reunión hoy mismo y descubre cómo Kliks puede ayudarte a crecer tu negocio. 🚀 https://kliksdigital.com/ 📩 info@kliksdigital.com
    1 work in Digital Strategy
    Active in Colombia
    From €200 for Digital Strategy
  • Goula

    Goulacertified-flagverified-flag

    (0 review)
    Goula - Especialistas en marketing y negocios de la industria de alimentos y bebidas.  En alianza con Sopexa.
    1 work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Chispa Lab

    Chispa Labverified-flag

    (0 review)

    Design Partner Studio

    We are a branding and digital product studio that collaborates with startups and companies to innovate and build products and services through exceptional digital experiences. We deliver real value, working closely with our clients to achieve swift and impactful results through design innovation and technology. We unite with big brands and startups in various industries to create memorable experiences driven by user‑centered design that drives productivity and increases revenue. Our Services: Product and Brand Strategy UI/UX Design Branding Marketing Websites Web and Mobile Development Let's create something great together.
    1 work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • wdmarketingdigital

    wdmarketingdigitalverified-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    No work in Digital Strategy
    Active in Colombia
    From €400 for Digital Strategy
  • SR.BRANDSTUDIO

    SR.BRANDSTUDIOverified-flag

    5
    (1 review)

    Let´s do a New Brand®

    Recommended
    Es un estudio creativo independiente con visión global. Nuestra misión está en ayudar a las empresas a resolver problemas de comunicación visual, creando experiencias de marca única y vanguardista. Impulsamos la transformación cultivando la creatividad, liderados por la estrategia, expresados por el diseño y la comunicación.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Mr. Branding

    Mr. Brandingverified-flag

    4.6
    (1 review)

    Everything Builds Brand

    Recommended
    Everything builds a brand We value every detail surrounding a brand, generating synergy between its essence and all their touchpoints. Mr Branding is a branding and integrated communications agency focused on brands and businesses objectives. Our mainly-remote and multidisciplinary team, share enormous curiosity, enjoy asking and soaking up each topic, to convey the essence of each brand.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • the brandbean

    the brandbeanverified-flag

    (0 review)
    Award-winner
    Need help creating a new brand? Want to sort out or update your existing brand? The Brandbean is here to help. We are a boutique brand development agency - a small, but highly experienced team of brand experts and graphic designers. Founded by Hilary Strong, ex Brand Director at Unilever, The Brandbean offers a range of services, all focused on growing brands. The Brandbean offers three key services. Qualitative market research . We firmly believe in the value of consumer insight, of deeply understanding what consumers want and why. From focus groups to ethnographic studies, offline, online or blended solutions, we conduct all sorts of qualitative research. We are set up to respond to briefs in Spain, UK, France and right across Central and Latin America. Our own investigations have included pioneering research into women and advertising, Gen Z and Millennials. Brand positioning, strategy and innovation. At the core of a strong brand lies a clear sense of positioning; who is the brand for, what do they need, and how does this brand meet that need, better than the competition. We work with clients to ensure that their brands are really clearly thought through, always unique, always with a clear sense of identity and purpose. We work on strategy – weaving business and brand together. We run innovation workshops, often side by side with clients to create pipeline of innovation ideas, all consistent with the brand and its purpose. Brand identity, graphic design, content and communication.  We take brand positioning and turn it into highly creative, unique unique branding solutions that include core brand logos, visual assets, key messages and all brought to life in a set of brand guidelines. We create content strategies and turn them into materials. We bring brands to life in ongoing communication materials including corporate literature, advertising campaigns, videos, websites, social media content, conference material……the list is endless! Our clients include major multinationals (Unilever, ESPN, Coca-Cola, Diageo, McDonald’s) as well as all sorts of start-ups. In fact over the last few years we have helped launch over 30 new brands including bars, restaurants, clothes, food and technology brands. For these new businesses, we have helped develop the concept, the name and then created all branding and launch material. Our team is small but multinational, Directors with senior experience (15+ years each) and working personally on every project, side by side with clients. We have offices in Barcelona and Buenos Aires, combining the very best of European and Latin American talent and creativity. In the last year we have worked with clients in Mallorca, Barcelona, UK, France, Colombia, Chile, Argentina, Mexico, Brazil and the USA. Drop us a line to see more of our case studies or have a chat about a brief, we would love to help you grow your brand. 
    1 work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • iHDMAX

    iHDMAXcertified-flagverified-flag

    (0 review)
    http://t.co/gWuibfuyK7
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • We are an off as well as on line Media Agency with a clear vocation for service, efficacy and availability. We offer both national and international campaigns, proving and demonstrating to all our partners that, in addition to the traditional branding objectives, each ad investment entails a concrete, measurable and objective ROI.  We have partners, not clients. Their objectives are our objectives, their success is our success. Their growth and development is our growth. Our loyalty is their relief. Our agility and Know How is their innovation and leadership.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Tres Pi Medios

    Tres Pi Medioscertified-flagverified-flag

    (0 review)

    Boost B2B Ad Success

    At TresPi Medios, we consider ourselves pioneers in the digital space. We take pride in being a driving force in global digital marketing based in Colombia, with extended presence in the United States and Mexico. We are proudly Latin American talent. At TresPi Medios, we embrace a scientific approach to creativity. Every B2B strategy we propose is backed by extensive research and analysis, allowing us to continually refine our campaigns through a process of constant iteration. Our success stories, with renowned clients such as Twilio, Globant, Kimberly Clark, and Stanley Black & Decker, speak for themselves. In addition to our audiovisual production and digital marketing services, we excel in offering specialized automation solutions in Salesforce’s Marketing Cloud, including Pardot. This enables us to take your marketing strategies to the next level by combining cutting-edge technology with a strategic and creative approach. TresPi Medios is more than an agency; we are a force propelling the digital universe towards new horizons. Our ship is led by a passionate team committed to excellence and innovation in every project we undertake. Together, we sail towards success with passion, creativity, and determination. Jota Agredo este si ? At TresPi Medios, we consider ourselves pioneers in the digital space. We take pride in being a driving force in global digital marketing based in Colombia, with extended presence in the United States and Mexico. We are proudly Latin American talent. At TresPi Medios, we embrace a scientific approach to creativity. Every B2B strategy we propose is backed by extensive research and analysis, allowing us to continually refine our campaigns through a process of constant iteration. Our success stories, with renowned clients such as Twilio, Globant, Kimberly Clark, and Stanley Black & Decker, speak for themselves. In addition to our audiovisual production and digital marketing services, we excel in offering specialized automation solutions in Salesforce’s Marketing Cloud, including Pardot. This enables us to take your marketing strategies to the next level by combining cutting-edge technology with a strategic and creative approach. TresPi Medios is more than an agency; we are a force propelling the digital universe towards new horizons. Our ship is led by a passionate team committed to excellence and innovation in every project we undertake. Together, we sail towards success with passion, creativity, and determination.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • WX Digital Agency

    WX Digital Agencycertified-flagverified-flag

    (0 review)

    We build revenue-driving systems on HubSpot for businesses that are ready to grow - and keep on grow

    We build revenue-driving systems on HubSpot for businesses that are ready to grow - and keep on growing. At WX Digital Agency, you'll work with a results-oriented team of digital business and HubSpot experts from all over the world. We tap into our unique combination of expertises and backgrounds to deliver outstanding performance for your branding, website, digital marketing, and CRM implementation. Our values are collaboration, honesty, relationships, professionalism and positivity. They're the glue that binds our team across continents, timezones and disciplines. You'll see them reflected in all of our (inter)actions, including the companies we work with. If these principles resonate with you, let's talk about how we can help your business grow.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • La Guapa Media

    La Guapa Mediacertified-flagverified-flag

    (0 review)
    Award-winner
    La Guapa es una compañia especializada en tecnología de contar historias aplicadas a la publicidad, marketing, branding, comunicaciones y entretenimiento. Con 10 años de experiencia en el mercado, se ha posicionado en Colombia como una opción independiente y muy competitiva dado el uso de tecnologías de vanguardia. 
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Boosterwise

    Boosterwisecertified-flagverified-flag

    (0 review)
    Agencia consultora en marketing digital y comunicación creativa. Nuestro centro neurálgico se encuentra en la Ciudad de México y contamos con oficinas operativas en Mérida, México y creativas en Bogotá, Colombia.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • DMFusion

    DMFusionverified-flag

    (0 review)
    DMFusion es una agencia digital integral nacida hace, desarrolladora de sitios web, aplicaciones móviles, e-commerce, estrategias de comunicación integral, pauta publicitaria en medios digital, creatividad. Somos una agencia digital con más de 23 años, conformada por un equipo de profesionales de la comunicación, curiosos, creativos y apasionados de las redes sociales.  Disfrutamos lo que mejor sabemos hacer: planificar, crear, gestionar y comunicar. Nuestra VISIÓN, “ser un socio estratégico, no un proveedor de servicios” nos ha permitido siempre pensar del lado del cliente, buscando alcanzar sus objetivos. Nuestros principales compromisos son la innovación, la dedicación, el trabajo en equipo, la responsabilidad, la creatividad, y la pasión que le dedicamos a los proyectos de nuestros clientes, de quienes aprendemos diariamente.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Somos la empresa líder de SEO en Latinoamérica, en el 2020 Alexa la calificadora número 1 de sitios web nos califica en el #80,347 entre los más de 10 billones de sitios web existentes en el mundo. Posicionamos su marca, producto o servicio en los motores de búsqueda más importantes como Yahoo, Google y Bing. Atraeremos tráfico calificado a su sitio otorgándole datos como  Nombre, Correo, IP, Hora, brindándole seguimiento automatizado, mejorando conversiones, al posicionarle en la primera página de Google. Eso siempre tendrá un gran Retorno de Inversión, contáctenos..!! Nuestra empresa brinda servicios de: Diseño web responsivo UX /IU, Redes sociales, análisis de competencia, análisis de palabras clave, optimización off y on page, corrección de errores, creación de contenidos, creación de enlaces, diseño gráfico, velocidad y apertura de página, creación de blog, programación de robots TXT, sitemap XML. Creación de Video campañas. Creación de contenido fresco y relevante, creación y desarrollo de campañas de Facebook, Instagram, Youtube, Twitter y Linkedin. Apertura de mercados locales, nacionales e internacionales, Creación de Landing pages y servicios de SEM, El mundo digital es el futuro presente. Contáctenos para una consulta gratuita sobre el status actual de su página web.   Contactanos: CDMX T: 558 000 8323 GUADALAJARA Fernando Waiman T: 33 8000 0337 MONTERREY Eduardo Vázquez T: 81 8133 3721   VERACRUZ Abigail Meza T: 271 736 8985 LEÓN Tanios Tabet T: 477 214 3910 PUEBLA Mariana Gutiérrez T: 222 689 1658   TIJUANA Frida García T: 664 615 7356 MÉRIDA T: 999 500 3156 AGUASCALIENTES T: 449 261 6209 SAN LUIS POTOSÍ T: 444 87042 97
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Quiroga

    Quirogaverified-flag

    (0 review)
    Resultados que suman valor real a tu marca MAXIMIZAMOS TU PRESUPUESTO DE MARKETING EN TODA LATINOAMÉRICA Somos la mayor Agencia de Medios Independiente que atiende cuentas nacionales e internacionales en cada país, trabajando con recursos locales y las mejores prácticas globales a través de toda América. Nos mueve el compromiso con los resultados de nuestros clientes y trabajamos para maximizarlos: nos respalda un sólido conocimiento del consumidor, el marketing, la comunicación y la compra de medios. Nuestra escala, experiencia y trabajo constante con primeras marcas internacionales desde hace más de 15 años nos convierten en líderes de nuestra industria.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • AOM Comunicación y Marketing Digital

    AOM Comunicación y Marketing Digitalverified-flag

    (0 review)

    Cultivamos Marcas

    Tu partner estratégico de comunicación y marketing. En AOM Comunicación y Marketing Digital ofrecemos un amplio catálogo de servicios especializados a medida de nuestros clientes. Somos expertos en gestión de reputación y crisis, comunicación, marketing digital, inbound marketing, SEO, Analítica y eventos corporativos en sectores como el industrial, medioambiente, salud o seguros entre otros. Tenemos sede en Sevilla, Madrid y Bogotá.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • SUBE AGENCIA DIGITAL

    SUBE AGENCIA DIGITALverified-flag

    (0 review)

    Te elevamos al más alto nivel

    En SUBE, nos enfocamos en satisfacer necesidades de negocio . Teniendo en cuenta que el mundo cambia constantemente y que los mercados se vuelven cada vez más emergentes, buscamos que nuestros servicios y nuestra adaptabilidad al cambio permitan a nuestros clientes obtener el mejor ROI.  Como agencia de marketing digital, ayudamos a nuestros clientes a resolver problemas de negocio fusionando creatividad, estrategia e innovación, a través de las diversas plataformas y medios digitales. Nos apasiona trabajar con clientes de diferentes industrias y modelos de negocio y nuestra principal labor es hacer que nuestros clientes vendan más e impulsarlos a que triunfen en la cultura digital.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Award-winner
    TwoReality se fundó en 2010 con el objetivo de explorar y ampliar el papel que tendrá la innovación tecnológica en el sector de la comunicación. TwoReality es una agencia creativa especializada en la creación de experiencias digitales 360 3D . Diseñamos y desarrollamos las mejores experiencias inmersivas para contribuir a la consolidación de empresas y marcas a través de la integración de tecnologías innovadoras en los modelos de negocio existentes. Estamos especializados en tecnologías de vanguardia, como Realidad Aumentada y Realidad Virtual. Realizamos contenidos 3D digitales exclusivos para dispositivos portátiles, tracking de movimiento del cuerpo, control a través de gestos y mucho más.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • tutrup

    tutrupcertified-flagverified-flag

    (0 review)
    Somos una "trup" o "tropa" de especialistas con presencia en  Argentina, Chile y Brasil , luchando por una buena causa: La de conectar tu marca con personas a través de las ideas. Porque una buena idea puede ser el arma más eficaz del mundo. Estamos blindados de conocimientos, somos una fuerza que observa y analiza el target para poder dar en el objetivo.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Tuatara Boutique Agency

    Tuatara Boutique Agencyverified-flag

    (0 review)

    Digital results require Mutualistic relationships. Digital Agency ffrom Colombia to the world.

    Tuataras 🦎, New Zealand Reptiles inspire us with its behavior to breathe what we call Mutualism, a way of living, managing and relating with clients that our company acquired. Its goal is to harvest long-term relations🤝where transparency, trust, and communication ends in a win-win. 1. We believe in people💚, mutualism and transparent relationships, which strengthen the bonds of those involved. 2. We are extensionsof your work team, under clear, logical and transparent processes for the parties, generating learning and results for boards of directors. 3. We are consultants in business digital transformation with an emphasis on sales. We plan and execute strategies that involve: - Digital Marketing 📈 - Software Development 💻 - Graphic Design 💎 Thank you for reading.
    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy
  • Paxzu-Agencia de marketing digital

    Paxzu-Agencia de marketing digitalverified-flag

    (0 review)

    Nuestro objetivo es hacer de tus canales digitales, los más importantes dentro de tu empresa.

    No work in Digital Strategy
    Active in Colombia
    From €1000 for Digital Strategy

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Companies technical in digital strategy located in Colombia!

Sortlist helps you find the best agency in Colombia

The site, invented by Sortlist, aids marketers who require to smoke out the out-of-this-world communication bureau for their task. And now Sortlist is blessed with a network incorporating more than 50.000 firms, we can assure you that your digital marketing company in Colombia doubtlessly is in our inventory.

Prevail in digital strategy formations thanks to one of our companies in Colombia.

digital marketing companies have a mass of diverse experiences, for example, they are very experienced in digital strategy formations and linkbuilding. Contacting a digital marketing company for your unborn activity in Colombia will let you build an practical and organized digital strategy program for your firm.

To be rewarding in, for instance, a operation in digital strategy formations or in digital strategy building, is cooperating with a technical firm in digital strategy of superior importance. And your firm presumably realizes that there is a mass of technical companies like that internationally. So keep everything simple and contact Sortlist.

Colombia, a profuseness of benefits to teaming up with a digital marketing company.

What we also speedily are able to assert is that someone who puts money in a project in digital strategy with no technology to weigh the outcomes is foolish. Thus approaching a digital marketing company is the finest solution to quickly measure that payoff.

Obviously, encountering the most adapted digital marketing company is demanding. Our site is for your firm thusly a undeniable occasion to encounter the optimal firm in Colombia. Phone Sortlist and we will do everything in our capacity to find the most skilled firm specialised in digital strategy for you.

digital strategy, identify quality collaborators in Colombia.

Sortlist 's goal is to frame an index of the 5 fitting digital marketing companies for your operation. And they will thus, due to their capabilities and competencies, build importance for your operation in linkbuilding or digital strategy building. Thus trust us, the companies in Colombia will have all thing closely under control.



Frequently Asked Questions.


A Digital Strategy Company prices ranging between 9500$ to 11600$, depending on data compiled by Sortlist from 31 projects. The real expense might change based on your unique needs of your project, the sophistication, and the skill offered by the firm.


Working with a Digital Strategy Agency in Colombia offers numerous advantages, including tapping into the country's rapidly growing tech scene and its skilled, cost-effective workforce. Colombia's strategic location in the Americas allows for easy collaboration with North and Latin American markets, while its rich culture encourages creative thinking and innovative solutions. Additionally, the Colombian government actively supports the digital economy through investments and initiatives in infrastructure, education, and entrepreneurship, fostering a thriving environment for digital agencies to flourish and deliver high-quality services.


Digital strategy agencies play a pivotal role in helping businesses establish and execute efficient online approaches to achieve their marketing and sales objectives. They evaluate a company's digital presence and target audience, pinpointing areas for growth and enhancement. By leveraging their proficiency in digital technologies and marketing tactics, these agencies devise all-encompassing plans that cover various aspects of digital channels, such as Lead Generation, Digital Transformation, and Digital Consulting. Additionally, they consistently track the outcomes of these digital campaigns, making data-driven modifications to optimize performance and maximize ROI. With their comprehensive knowledge of the ever-changing digital environment, digital strategy agencies are instrumental in outpacing competitors and fostering long-term business growth. Furthermore, they offer Strategic Consulting services to ensure businesses stay on the right path towards success.